TIM-4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TIM-4 Antibody - BSA Free (NBP1-87569) is a polyclonal antibody validated for use in Multiplex Immunofluorescence, IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TIMD4 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500-1:1000
- Multiplex Immunofluorescence
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for TIM-4 Antibody - BSA Free
Background
The T cell immunoglobulin and mucin domain containing protein (TIM) family encodes cell surface receptors that are involved in the regulation of T helper (Th) -1 and -2 cell-mediated immunity. Studies have shown that TIM 4, which is preferentially expressed on macrophages and dendritic cells, is the natural ligand of TIM 1, and that this binding leads to T-cell expansion and cytokine production. Unlike other members of the TIM family, TIM 4 lacks a putative tyrosine phosphorylation signal sequence in its intracellular domain (Kuchroo et al, 2003). The TIM 4 gene maps to a locus associated with predisposition to asthma in both mice and humans and with its connection to TIM 1-triggered Th2 responsiveness, may be considered as a candidate disease/predisposition gene for asthma
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC, mIF
Publications for TIM-4 Antibody (NBP1-87569) (0)
There are no publications for TIM-4 Antibody (NBP1-87569).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TIM-4 Antibody (NBP1-87569) (0)
There are no reviews for TIM-4 Antibody (NBP1-87569).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TIM-4 Antibody (NBP1-87569) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TIM-4 Products
Research Areas for TIM-4 Antibody (NBP1-87569)
Find related products by research area.
|
Blogs on TIM-4