TIF1 alpha Recombinant Protein Antigen

Images

 
There are currently no images for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIF1 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIF1 alpha.

Source: E. coli

Amino Acid Sequence: NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM24
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56418.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIF1 alpha Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase TRIM24
  • EC 6.3.2
  • EC 6.3.2.-
  • hTIF1
  • PTC6
  • RING finger protein 82
  • RNF82
  • RNF82Tif1a
  • TIF1 alpha
  • TIF1
  • TIF1A
  • TIF1-alpha
  • TIF1ATIF1ALPHA
  • TIF1TF1A
  • transcription intermediary factor 1-alpha
  • transcriptional intermediary factor 1
  • TRIM24
  • tripartite motif containing 24
  • tripartite motif-containing 24
  • Tripartite motif-containing protein 24

Background

TIF1 alpha is encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12264
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83747
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-2518
Species: Hu
Applications: Flow-IC, ICC/IF, WB
DY8198-05
Species: Hu
Applications: ELISA
H00051127-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00023316-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-56418PEP
Species: Hu
Applications: AC

Publications for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP) (0)

There are no publications for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP) (0)

There are no reviews for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIF1 alpha Products

Research Areas for TIF1 alpha Recombinant Protein Antigen (NBP2-56418PEP)

Find related products by research area.

Blogs on TIF1 alpha

There are no specific blogs for TIF1 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIF1 alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM24