TGFBRAP1 Antibody - BSA Free

Western Blot: TGFBRAP1 Antibody [NBP2-85904] - Host: Rabbit. Target Name: TGFBRAP1. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TGFBRAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TGFBRAP1 Antibody - BSA Free (NBP2-85904) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TGFBRAP1. Peptide sequence: FTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVIDKRLQKEEYHT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGFBRAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TGFBRAP1 Antibody - BSA Free

• TGF-beta receptor-associated protein 1
• transforming growth factor, beta receptor associated protein 1
• transforming growth factor-beta receptor-associated protein 1
• TRAP1
• TRAP-1

Background

TGFBRAP1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGFBRAP1