TBX3 Antibody (3G9F1)

Western Blot: TBX3 Antibody (3G9F1) [NBP3-16848] - Western blot analysis of extracts of various cell lines, using TBX3 antibody (NBP3-16848) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 3G9F1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TBX3 Antibody (3G9F1) Summary

• Description: Novus Biologicals Rabbit TBX3 Antibody (3G9F1) (NBP3-16848) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119). SIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TBX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBX3 Antibody (3G9F1)

• bladder cancer related protein XHL
• T-box 3
• T-box protein 3
• T-box transcription factor TBX3
• TBX3
• TBX3-ISO
• ulnar mammary syndrome
• UMS
• XHL

Background

Tbx3 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBX3