RPP14 Antibody

Images

 
Western Blot: RPP14 Antibody [NBP1-80965] - Analysis in control (vector only transfected HEK293T lysate) and RPP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RPP14 Antibody [NBP1-80965] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RPP14 Antibody [NBP1-80965] - Staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPP14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAILRICSSGLVK
Specificity
Specificity of human RPP14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPP14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPP14 Protein (NBP1-80965PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPP14 Antibody

  • EC 3.1.26.5
  • EC 4.2.1.-
  • FLJ31508
  • HsHTD2
  • P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  • ribonuclease P (14kD)
  • ribonuclease P 14kDa subunit
  • ribonuclease P protein subunit p14
  • ribonuclease P/MRP 14kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-59875
Species: Hu
Applications: WB
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPP14 Antibody (NBP1-80965) (0)

There are no publications for RPP14 Antibody (NBP1-80965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP14 Antibody (NBP1-80965) (0)

There are no reviews for RPP14 Antibody (NBP1-80965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPP14 Antibody (NBP1-80965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPP14 Products

Bioinformatics Tool for RPP14 Antibody (NBP1-80965)

Discover related pathways, diseases and genes to RPP14 Antibody (NBP1-80965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP14 Antibody (NBP1-80965)

Discover more about diseases related to RPP14 Antibody (NBP1-80965).
 

Pathways for RPP14 Antibody (NBP1-80965)

View related products by pathway.

PTMs for RPP14 Antibody (NBP1-80965)

Learn more about PTMs related to RPP14 Antibody (NBP1-80965).

Blogs on RPP14

There are no specific blogs for RPP14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP14
Entrez