TBX2 Antibody (7G5)

Images

 
Western Blot: TBX2 Antibody (7G5) [H00006909-M01] - TBX2 monoclonal antibody (M01), clone 7G5 Analysis of TBX2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: TBX2 Antibody (7G5) [H00006909-M01] - Analysis of monoclonal antibody to TBX2 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: TBX2 Antibody (7G5) [H00006909-M01] - Analysis of TBX2 over-expressed 293 cell line, cotransfected with TBX2 Validated Chimera RNAi ( Cat # H00006909-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TBX2 Antibody (7G5) [H00006909-M01] - Analysis of TBX2 expression in transfected 293T cell line by TBX2 monoclonal antibody (M01), clone 7G5.Lane 1: TBX2 transfected lysate(74.1 KDa).Lane 2: ...read more
Sandwich ELISA: TBX2 Antibody (7G5) [H00006909-M01] - Detection limit for recombinant GST tagged TBX2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, RNAi, S-ELISA
Clone
7G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TBX2 Antibody (7G5) Summary

Immunogen
TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
Specificity
TBX2 - T-box 2
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Publications
Read Publication using
H00006909-M01 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28035050).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TBX2 Antibody (7G5)

  • FLJ10169
  • T-box 2
  • T-box protein 2
  • T-box transcription factor TBX2
  • TBX2

Background

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4509
Species: Hu
Applications: WB, ICC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-85889
Species: Hu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-86846
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006909-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA

Publications for TBX2 Antibody (H00006909-M01)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TBX2 Antibody (H00006909-M01) (0)

There are no reviews for TBX2 Antibody (H00006909-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX2 Antibody (H00006909-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBX2 Products

Array H00006909-M01

Bioinformatics Tool for TBX2 Antibody (H00006909-M01)

Discover related pathways, diseases and genes to TBX2 Antibody (H00006909-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX2 Antibody (H00006909-M01)

Discover more about diseases related to TBX2 Antibody (H00006909-M01).
 

Pathways for TBX2 Antibody (H00006909-M01)

View related products by pathway.

PTMs for TBX2 Antibody (H00006909-M01)

Learn more about PTMs related to TBX2 Antibody (H00006909-M01).
 

Research Areas for TBX2 Antibody (H00006909-M01)

Find related products by research area.

Blogs on TBX2

There are no specific blogs for TBX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX2 Antibody (7G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX2
Entrez
OMIM
Uniprot