Synaptopodin Antibody

Images

 
Immunohistochemistry: Synaptopodin Antibody [NBP2-68919] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptopodin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLLRHLEK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNPO
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
Synaptopodin Recombinant Protein Antigen (NBP2-68919PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Synaptopodin Antibody

  • KIAA1029
  • Synaptopodin
  • SYNPO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1556
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-81826
Species: Hu
Applications: IHC, IHC-P
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90625
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3844
Species: Hu, Mu
Applications: IHC
DVE00
Species: Hu
Applications: ELISA
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-68919
Species: Hu
Applications: IHC, IHC-P

Publications for Synaptopodin Antibody (NBP2-68919) (0)

There are no publications for Synaptopodin Antibody (NBP2-68919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptopodin Antibody (NBP2-68919) (0)

There are no reviews for Synaptopodin Antibody (NBP2-68919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptopodin Antibody (NBP2-68919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptopodin Products

Bioinformatics Tool for Synaptopodin Antibody (NBP2-68919)

Discover related pathways, diseases and genes to Synaptopodin Antibody (NBP2-68919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptopodin Antibody (NBP2-68919)

Discover more about diseases related to Synaptopodin Antibody (NBP2-68919).
 

Pathways for Synaptopodin Antibody (NBP2-68919)

View related products by pathway.

PTMs for Synaptopodin Antibody (NBP2-68919)

Learn more about PTMs related to Synaptopodin Antibody (NBP2-68919).
 

Research Areas for Synaptopodin Antibody (NBP2-68919)

Find related products by research area.

Blogs on Synaptopodin

There are no specific blogs for Synaptopodin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptopodin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNPO