Survivin Recombinant Protein Antigen

Images

 
There are currently no images for Survivin Recombinant Protein Antigen (NBP2-48494PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Survivin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BIRC5.

Source: E. coli

Amino Acid Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BIRC5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48494.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Survivin Recombinant Protein Antigen

  • API4
  • apoptosis inhibitor 4
  • Apoptosis inhibitor survivin
  • baculoviral IAP repeat-containing 5
  • Baculoviral IAP Repeat-Containing Protein 5
  • BIRC5
  • EPR-1
  • IAP4
  • survivin variant 3 alpha
  • Survivin

Background

Survivin (BIRC5 or IAP4) is the smallest member of the inhibitor of apoptosis (IAP) proteins, containing only a single baculovirus IAP repeat (BIR) domain and lacking the C-terminal RING domain. Survivin has a theoretical molecular weight of 16.5 kDa (wild-type protein) and exists as ten splice variant forms including the most predominant isoforms, survivin-2B and surviving-DeltaEx3 (1). It also undergoes phosphorylation by PKA, Plk1, Cdk1, CKII and Aurora B at multiple sites (e.g. Serine 20 and Threonine 34, 53 and 117).

Besides being highly abundant in fetal development and expressed in proliferating adult cells such as activated T lymphocytes, erythroblasts, and self-renewing stem cells, survivin is generally absent in adult tissues. However, it is elevated in common cancers such as lung, colon, pancreas, breast and prostate where it drives proliferation, metastasis, poor prognosis, and decreased patient survival (2).

Survivin has been shown to be involved in multiple cellular processes including cell cycle progression, mitotic spindle assembly, kinetochore attachment, angiogenesis, migration, and its anti-apoptotic activity has been linked to both its monomeric and homodimeric forms. Survivin impacts the function of other IAP members, c-IAP1 and c-IAP-2, or modulates the inhibitory activity of XIAP against caspases by forming a stable complex with XIAP and HBXIP. During the intrinsic apoptotic pathway, survivin may prevent the release of mitochondrial APAF1 into the cytoplasm or hinder the association of SMAC with other IAPS, which results in prolonged cell survival (3).

References

1. Sah NK, Seniya C. (2015) Survivin splice variants and their diagnostic significance. Tumour Biol. 36(9):6623-31. PMID: 26245993

2. Lladser A, Sanhueza C, Kiessling R, Quest AF. (2011) Is survivin the potential Achilles' heel of cancer? Adv Cancer Res. 111:1-37. PMID: 21704829

3. Wheatley SP, Altieri DC. (2019) Survivin at a glance. J Cell Sci. 132(7). PMID: 30948431

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-14214
Species: Hu
Applications: IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
375-TL
Species: Hu
Applications: BA
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
NBP2-48494PEP
Species: Hu
Applications: AC

Publications for Survivin Recombinant Protein Antigen (NBP2-48494PEP) (0)

There are no publications for Survivin Recombinant Protein Antigen (NBP2-48494PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Survivin Recombinant Protein Antigen (NBP2-48494PEP) (0)

There are no reviews for Survivin Recombinant Protein Antigen (NBP2-48494PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Survivin Recombinant Protein Antigen (NBP2-48494PEP). (Showing 1 - 1 of 1 FAQ).

  1. Can I use this antibody with species other than those listed?
    • The species we have listed are validated and therefore have a 100% guarantee to work with this antibody. We cannot guarantee that this will work with other species.

Additional Survivin Products

Research Areas for Survivin Recombinant Protein Antigen (NBP2-48494PEP)

Find related products by research area.

Blogs on Survivin. Showing 1-10 of 16 blog posts - Show all blog posts.


  Read full blog post.

The Ins and Outs of Survivin
By Rachel M.A. Linger, Ph.D.What is survivin?Survivin is a small (16.5 kDa) protein normally found in human fetal tissue. In contrast, survivin is typically undetectable in most normal adult tissues. Expression of ...  Read full blog post.

Survivin - an inhibitor of apoptosis that drives tumorigenesis and metastasis
Apoptosis is the tightly regulated process of programmed cell death. It plays an important role in normal physiologic development but has also been implicated in a number of diseases. Apoptosis is constantly downregulated by a family of anti-apop...  Read full blog post.

Survivin - an inhibitor of apoptosis protein
Survivin is an anti-apoptotic protein which is the smallest protein within a large family of proteins including X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, NAIP, and Livin. Survivin is responsible for a wide range of basic cellula...  Read full blog post.

Cytochrome C - a mediator of apoptosis
Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain.  Additionally, cytochrome c has also been identified as a player in programmed cell death (apop...  Read full blog post.

PCNA (Proliferating cell nuclear antigen, polymerase delta auxiliary protein)
PCNA is a nuclear protein essential for DNA replication as well as DNA excision and mismatch repair pathways. It coordinates the recruitment and association of needed components during both of these processes, both of which are essential for cell cycl...  Read full blog post.

Survivin is thrivin'
The survivin anti-apoptotic protein is the smallest member of a large family of proteins such as X-linked IAP, c-IAP1 and 2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates basic physiological events such as the cell cycle, tumor...  Read full blog post.

Livin: On a Prayer
Livin is a member of the inhibitor of apoptosis proteins (IAP) family that regulates programmed cell death. The Livin protein contains a single baculovirus IAP repeat (BIR) essential for function, along with a COOH-terminal RING-type zinc finger domai...  Read full blog post.

Survivin: As long as I know how to live I know I will
Survivin is an anti-apoptotic protein from a large family with related members such as X-linked IAP, cIAP1 and cIAP2, IAP-like protein-2, melanoma IAP, Livin, and NAIP. Survivin regulates fundamental physiological events including the cell cycle, feta...  Read full blog post.

Survivin: Infographic
Survivin is involved in promoting cell proliferation and is an inhibitor of apoptosis. Survivin has a critical role in cancer proliferation and neural development. It may have an impact on neural cell proliferative responses following brain injury.L...  Read full blog post.

Showing 1-10 of 16 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Survivin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC5