Steroid sulfatase Antibody

Images

 
Western Blot: steroid sulfatase Antibody [NBP1-69686] - This Anti-STS antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-69686] - Immunolocalization of Steroid Sulfatase in normal human endometrium in proliferative phase of the menstrual cycle using NBP1-69686 at a ...read more
Immunohistochemistry-Paraffin: Steroid sulfatase Antibody [NBP1-69686] - Immunolocalization of Steroid Sulfatase in human endometrial tissue sample with endometrial cancer type I using NBP1-69686 at a concentration of ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Steroid sulfatase Antibody Summary

Immunogen
Synthetic peptides corresponding to STS(steroid sulfatase (microsomal), isozyme S) The peptide sequence was selected from the middle region of STS. Peptide sequence EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4 ug/ml
Application Notes
This is a rabbit polyclonal antibody against STS and was validated on Western Blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Steroid sulfatase Antibody

  • ARSC1ES
  • ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S
  • Arylsulfatase C
  • ASC
  • EC 3.1.6
  • EC 3.1.6.2
  • estrone sulfatase
  • SSDD
  • steroid sulfatase (microsomal), isozyme S
  • Steroid sulfatase
  • steryl-sulfatase
  • Steryl-sulfate sulfohydrolase
  • XLI

Background

Steroid sulfatase catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB5545
Species: Hu
Applications: WB
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-69686
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Steroid sulfatase Antibody (NBP1-69686) (0)

There are no publications for Steroid sulfatase Antibody (NBP1-69686).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Steroid sulfatase Antibody (NBP1-69686) (0)

There are no reviews for Steroid sulfatase Antibody (NBP1-69686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Steroid sulfatase Antibody (NBP1-69686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Steroid sulfatase Products

Bioinformatics Tool for Steroid sulfatase Antibody (NBP1-69686)

Discover related pathways, diseases and genes to Steroid sulfatase Antibody (NBP1-69686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Steroid sulfatase Antibody (NBP1-69686)

Discover more about diseases related to Steroid sulfatase Antibody (NBP1-69686).
 

Pathways for Steroid sulfatase Antibody (NBP1-69686)

View related products by pathway.

PTMs for Steroid sulfatase Antibody (NBP1-69686)

Learn more about PTMs related to Steroid sulfatase Antibody (NBP1-69686).
 

Research Areas for Steroid sulfatase Antibody (NBP1-69686)

Find related products by research area.

Blogs on Steroid sulfatase

There are no specific blogs for Steroid sulfatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Steroid sulfatase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STS
Uniprot