STAT5a Antibody


Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: STAT5a Antibody [NBP1-81051] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: STAT5a Antibody [NBP1-81051] - Staining of human liver shows distinct positivity in bile duct cells.
Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

STAT5a Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
STAT5a Protein (NBP1-81051PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for STAT5a Antibody

  • MGF
  • signal transducer and activator of transcription 5A
  • STAT5
  • STAT5a


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, KO
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for STAT5a Antibody (NBP1-81051) (0)

There are no publications for STAT5a Antibody (NBP1-81051).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT5a Antibody (NBP1-81051) (0)

There are no reviews for STAT5a Antibody (NBP1-81051). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT5a Antibody (NBP1-81051) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional STAT5a Antibody Products

Related Products by Gene

Bioinformatics Tool for STAT5a Antibody (NBP1-81051)

Discover related pathways, diseases and genes to STAT5a Antibody (NBP1-81051). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT5a Antibody (NBP1-81051)

Discover more about diseases related to STAT5a Antibody (NBP1-81051).

Pathways for STAT5a Antibody (NBP1-81051)

View related products by pathway.

PTMs for STAT5a Antibody (NBP1-81051)

Learn more about PTMs related to STAT5a Antibody (NBP1-81051).

Blogs on STAT5a

There are no specific blogs for STAT5a, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our STAT5a Antibody and receive a gift card or discount.


Gene Symbol STAT5A

Customers Who Bought This Also Bought