STAT5a Antibody (NBP1-81051)

Images

 
Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: STAT5a Antibody [NBP1-81051] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: STAT5a Antibody [NBP1-81051] - Staining of human lymph node shows distinct cytoplasmic positivity in subsets of lymphoid cells.
Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAT5a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAT5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
STAT5a Protein (NBP1-81051PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAT5a Antibody

  • MGF
  • signal transducer and activator of transcription 5A
  • STAT5
  • STAT5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2988
Species: Mu, Rt
Applications: WB
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-48011
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-81051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STAT5a Antibody (NBP1-81051) (0)

There are no publications for STAT5a Antibody (NBP1-81051).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT5a Antibody (NBP1-81051) (0)

There are no reviews for STAT5a Antibody (NBP1-81051). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT5a Antibody (NBP1-81051) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT5a Products

Related Products by Gene

Bioinformatics Tool for STAT5a Antibody (NBP1-81051)

Discover related pathways, diseases and genes to STAT5a Antibody (NBP1-81051). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT5a Antibody (NBP1-81051)

Discover more about diseases related to STAT5a Antibody (NBP1-81051).
 

Pathways for STAT5a Antibody (NBP1-81051)

View related products by pathway.

PTMs for STAT5a Antibody (NBP1-81051)

Learn more about PTMs related to STAT5a Antibody (NBP1-81051).

Blogs on STAT5a

There are no specific blogs for STAT5a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT5a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT5A
Entrez