STAT5A Antibody - BSA Free

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: STAT5A Antibody [NBP1-81051] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.

Western Blot: STAT5A Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: STAT5A Antibody [NBP1-81051] - Staining of human liver shows no positivity in hepatocytes as expected.

ChIP-Exo-Seq composite graph for Anti-STAT5A (NBP1-81051) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STAT5A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STAT5A Antibody - BSA Free (NBP1-81051) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STAT5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STAT5A Recombinant Protein Antigen (NBP1-81051PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STAT5A Antibody - BSA Free

• MGF
• signal transducer and activator of transcription 5A
• STAT5
• STAT5a

Background

Stat5 is part of a 7 protein family known as signal transducer and activator of transcription (STAT) which contributes to signal transduction by cytokine, hormone and growth factor (1). Signal transducer and activator of transcription 5 (Stat5) functions both in signal transduction and activation of transcription. It has been found that cytoplasmic Stat5 is translocated to the nucleus in response to phosphorylation. Stat5 225; tyrosine phosphorylation is activated predominantly by IL2 but also by IL-3, IL-5, IL-7, IL-9, IL-15, G-CSF andGM-CSF(2). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity. NCoA-1/SRC-1 acts as a coactivator for both the alpha- and beta-isoforms of Stat5 (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STAT5A
• Entrez:
  • 6776(Human)
• Uniprot:
  • P42229(Human)