STAT5a Antibody

Images

 
Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: STAT5a Antibody [NBP1-81051] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
Immunohistochemistry-Paraffin: STAT5a Antibody [NBP1-81051] - Staining of human liver shows distinct positivity in bile duct cells.
Western Blot: STAT5a Antibody [NBP1-81051] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Mouse, RatSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

STAT5a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAT5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
STAT5a Protein (NBP1-81051PEP)

Alternate Names for STAT5a Antibody

  • MGF
  • signal transducer and activator of transcription 5A
  • STAT5
  • STAT5a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22975
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB15841
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
MAB2894
Species: Hu
Applications: WB
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NBP1-61704
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC, ICFlow
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for STAT5a Antibody (NBP1-81051) (0)

There are no publications for STAT5a Antibody (NBP1-81051).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT5a Antibody (NBP1-81051) (0)

There are no reviews for STAT5a Antibody (NBP1-81051). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT5a Antibody (NBP1-81051) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT5a Antibody Products

Related Products by Gene

Bioinformatics Tool for STAT5a Antibody (NBP1-81051)

Discover related pathways, diseases and genes to STAT5a Antibody (NBP1-81051). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT5a Antibody (NBP1-81051)

Discover more about diseases related to STAT5a Antibody (NBP1-81051).
 

Pathways for STAT5a Antibody (NBP1-81051)

View related products by pathway.

PTMs for STAT5a Antibody (NBP1-81051)

Learn more about PTMs related to STAT5a Antibody (NBP1-81051).

Blogs on STAT5a

There are no specific blogs for STAT5a, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol STAT5A
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81051 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought