SRRM2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SRRM2 Antibody [NBP1-90609] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SRRM2 Antibody [NBP1-90609] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRRM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRRM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SRRM2 Protein (NBP1-90609PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRRM2 Antibody

  • Cwc21
  • CWF21
  • DKFZp667L0421,300 kDa nuclear matrix antigen
  • DKFZp686O15166,300-KD
  • FLJ21926
  • FLJ22250
  • HSPC075
  • KIAA0324
  • MGC40295
  • RNA binding protein
  • ser/Arg-related nuclear matrix protein of 300 kDa
  • serine/arginine repetitive matrix 2
  • serine/arginine repetitive matrix protein 2
  • serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa
  • splicing coactivator subunit SRm300
  • SRL300
  • SRM300
  • SR-related nuclear matrix protein of 300 kDa
  • taxREB803
  • tax-responsive enhancer element-binding protein 803

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88723
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP2-04144
Species: Hu
Applications: WB, IHC-P, IP
NB100-56628
Species: Hu
Applications: WB
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-81865
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF7384
Species: Hu
Applications: ICC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-87019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for SRRM2 Antibody (NBP1-90609) (0)

There are no publications for SRRM2 Antibody (NBP1-90609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRRM2 Antibody (NBP1-90609) (0)

There are no reviews for SRRM2 Antibody (NBP1-90609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SRRM2 Antibody (NBP1-90609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRRM2 Products

SRRM2 NBP1-90609

Bioinformatics Tool for SRRM2 Antibody (NBP1-90609)

Discover related pathways, diseases and genes to SRRM2 Antibody (NBP1-90609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRRM2 Antibody (NBP1-90609)

Discover more about diseases related to SRRM2 Antibody (NBP1-90609).
 

Pathways for SRRM2 Antibody (NBP1-90609)

View related products by pathway.

PTMs for SRRM2 Antibody (NBP1-90609)

Learn more about PTMs related to SRRM2 Antibody (NBP1-90609).

Blogs on SRRM2

There are no specific blogs for SRRM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRRM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRRM2
Entrez
Uniprot