PPIG Antibody (4F8)

Images

 
Immunocytochemistry/ Immunofluorescence: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PPIG Antibody (4F8) [H00009360-M02] - Analysis of monoclonal antibody to PPIG on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: PPIG Antibody (4F8) [H00009360-M02] - Detection limit for recombinant GST tagged PPIG is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
4F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PPIG Antibody (4F8) Summary

Immunogen
PPIG (NP_004783, 13 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNK
Specificity
PPIG - peptidylprolyl isomerase G (cyclophilin G)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPIG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPIG Antibody (4F8)

  • CARS-cyclophilin
  • CARS-CypPPIase G
  • CASP10
  • Clk-associating RS-cyclophilin
  • Cyclophilin G
  • CYP
  • EC 5.2.1.8
  • MGC133241
  • peptidyl-prolyl cis-trans isomerase G
  • peptidylprolyl isomerase G (cyclophilin G)
  • peptidyl-prolyl isomerase G (cyclophilin G)
  • Peptidyl-prolyl isomerase G
  • Rotamase G
  • SCAF10
  • SR-cyclophilin
  • SRCyp
  • SR-cyp
  • SR-related CTD-associated factor 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30993
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
H00008837-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP3-00253
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-45552
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, IP
NBP1-30993
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-508
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00009360-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for PPIG Antibody (H00009360-M02) (0)

There are no publications for PPIG Antibody (H00009360-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIG Antibody (H00009360-M02) (0)

There are no reviews for PPIG Antibody (H00009360-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPIG Antibody (H00009360-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PPIG Products

Bioinformatics Tool for PPIG Antibody (H00009360-M02)

Discover related pathways, diseases and genes to PPIG Antibody (H00009360-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPIG Antibody (H00009360-M02)

Discover more about diseases related to PPIG Antibody (H00009360-M02).
 

Pathways for PPIG Antibody (H00009360-M02)

View related products by pathway.

PTMs for PPIG Antibody (H00009360-M02)

Learn more about PTMs related to PPIG Antibody (H00009360-M02).

Blogs on PPIG

There are no specific blogs for PPIG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPIG Antibody (4F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIG
Entrez
OMIM
Uniprot