![Western Blot: ISY1 Antibody [NBP1-81865] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ISY1-Antibody-Western-Blot-NBP1-81865-img0006.jpg "Western Blot: ISY1 Antibody [NBP1-81865] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, Rt, ChSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ISY1 Antibody - BSA Free (NBP1-81865) is a polyclonal antibody validated for use in IHC and WB. Anti-ISY1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ISY1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-81865 | Applications | Species |
|---|---|---|
| Youngworth IA Genetic and Genomic Analyses of Developmental Mutations in Chicken: Wingless-2 and Cleft Primary Palate Thesis (WB, Chicken) | WB | Chicken |
| Youngworth I, Delany M A Premature Stop Codon in RAF1 Is the Priority Candidate Causative Mutation of the Inherited Chicken Wingless-2 Developmental Syndrome. Genes (Basel) 2019-09-05 [PMID: 31075853] (WB, Chicken) | WB | Chicken |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ISY1 |
![Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human lymphoid tissues shows moderate to strong nuclear positivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/ISY1-Antibody-Immunohistochemistry-Paraffin-NBP1-81865-img0011.jpg "Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human lymphoid tissues shows moderate to strong nuclear positivity in a subset of lymphoid cells.")
![Western Blot: ISY1 Antibody [NBP1-81865] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/ISY1-Antibody-Western-Blot-NBP1-81865-img0005.jpg "Western Blot: ISY1 Antibody [NBP1-81865] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ISY1-Antibody-Immunohistochemistry-Paraffin-NBP1-81865-img0009.jpg "Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/ISY1-Antibody-Immunohistochemistry-Paraffin-NBP1-81865-img0010.jpg "Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ISY1-Antibody-Immunohistochemistry-Paraffin-NBP1-81865-img0012.jpg "Immunohistochemistry-Paraffin: ISY1 Antibody [NBP1-81865] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")