HINFP Antibody

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: HINFP Antibody [NBP2-32582] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Staining of human tonsil shows strong nuclear positivity in squamous epithelial cells.

Staining of human liver shows no nuclear positivity in hepatocytes as expected.

Analysis in human cell line SCLC-21H.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HINFP Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HINFP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Knockdown Validated reported in scientific literature (PMID:32058941).
• Control Peptide:

  HINFP Protein (NBP2-32582PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HINFP Antibody

• HiNF-PDKFZP434F162
• histone H4 gene-specific protein HiNF-P
• histone H4 transcription factor
• Histone nuclear factor P
• MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein
• MBD2-interacting zinc finger 1
• MBD2-interacting zinc finger protein
• Methyl-CpG-binding protein 2-interacting zinc finger protein
• MIZFDKFZp434F162
• ZNF743MBD2-interacting zinc finger

Background

MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase(HDAC) complex, and plays a role in DNA methylation and transcription repression.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HINFP Antibody (NBP2-32582)(1)

Publication using NBP2-32582

• Wang X, Chen X, Zhang X et al. A small-molecule inhibitor of PCSK9 transcription ameliorates atherosclerosis through the modulation of FoxO1/3 and HNF1 alpha EBioMedicine 2020-02-01 [PMID: 32058941] (KD, WB, Human)

Bioinformatics

• Gene Symbol: HINFP