HINFP Antibody


Western Blot: HINFP Antibody [NBP2-32582] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HINFP Antibody [NBP2-32582] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

HINFP Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HINFP Protein (NBP2-32582PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HINFP Antibody

  • HiNF-PDKFZP434F162
  • histone H4 gene-specific protein HiNF-P
  • histone H4 transcription factor
  • Histone nuclear factor P
  • MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein
  • MBD2-interacting zinc finger 1
  • MBD2-interacting zinc finger protein
  • Methyl-CpG-binding protein 2-interacting zinc finger protein
  • MIZFDKFZp434F162
  • ZNF743MBD2-interacting zinc finger


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu
Species: Hu
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu
Species: Hu
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HINFP Antibody (NBP2-32582) (0)

There are no publications for HINFP Antibody (NBP2-32582).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HINFP Antibody (NBP2-32582) (0)

There are no reviews for HINFP Antibody (NBP2-32582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HINFP Antibody (NBP2-32582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HINFP Products

Bioinformatics Tool for HINFP Antibody (NBP2-32582)

Discover related pathways, diseases and genes to HINFP Antibody (NBP2-32582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HINFP Antibody (NBP2-32582)

Discover more about diseases related to HINFP Antibody (NBP2-32582).

Pathways for HINFP Antibody (NBP2-32582)

View related products by pathway.

PTMs for HINFP Antibody (NBP2-32582)

Learn more about PTMs related to HINFP Antibody (NBP2-32582).

Blogs on HINFP

There are no specific blogs for HINFP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HINFP Antibody and receive a gift card or discount.


Gene Symbol HINFP