Pinin Antibody

Images

 
Western Blot: Pinin Antibody [NBP1-87784] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: Pinin Antibody [NBP1-87784] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKE
Specificity
Specificity of human Pinin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pinin Protein (NBP1-87784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pinin Antibody

  • 140 kDa nuclear and cell adhesion-related phosphoprotein
  • Desmosome-associated protein
  • Domain-rich serine protein
  • DRS protein
  • DRSP
  • DRSSR-like protein
  • Melanoma metastasis clone A protein
  • memA
  • neutrophil protein
  • Nuclear protein SDK3
  • pinin
  • pinin, desmosome associated protein
  • SDK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3646
Species: Hu
Applications: WB, ICC
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP1-87784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Pinin Antibody (NBP1-87784) (0)

There are no publications for Pinin Antibody (NBP1-87784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pinin Antibody (NBP1-87784) (0)

There are no reviews for Pinin Antibody (NBP1-87784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pinin Antibody (NBP1-87784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Pinin Antibody (NBP1-87784)

Discover related pathways, diseases and genes to Pinin Antibody (NBP1-87784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pinin Antibody (NBP1-87784)

Discover more about diseases related to Pinin Antibody (NBP1-87784).
 

Pathways for Pinin Antibody (NBP1-87784)

View related products by pathway.

PTMs for Pinin Antibody (NBP1-87784)

Learn more about PTMs related to Pinin Antibody (NBP1-87784).

Blogs on Pinin

There are no specific blogs for Pinin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNN