Pinin Antibody

Images

 
Western Blot: Pinin Antibody [NBP1-87784] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: Pinin Antibody [NBP1-87784] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Pinin Antibody [NBP1-87784] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKE
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Pinin Protein (NBP1-87784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pinin Antibody

  • 140 kDa nuclear and cell adhesion-related phosphoprotein
  • Desmosome-associated protein
  • Domain-rich serine protein
  • DRS protein
  • DRSP
  • DRSSR-like protein
  • Melanoma metastasis clone A protein
  • memA
  • neutrophil protein
  • Nuclear protein SDK3
  • pinin
  • pinin, desmosome associated protein
  • SDK3

Background

PNN is a nuclear and cell adhesion-related protein involved in cell adhesion, mRNA processing, and transcriptional regulation. PNN functions as a transcriptional regulator by relieving CtBP1-mediated repression of the E-cadherin gene. In the role of mRNA processing, PNN functions as a splicing regulator. The role of PNN in transcription and mRNA processing suggests the role of PNN as a coupling factor for the two processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

664-LI
Species: Hu
Applications: BA
AF2254
Species: Mu
Applications: IHC, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89996
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
G-125-C
Species: Hu
Applications:
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
DSHBG0B
Species: Hu
Applications: ELISA
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP1-87784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Pinin Antibody (NBP1-87784) (0)

There are no publications for Pinin Antibody (NBP1-87784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pinin Antibody (NBP1-87784) (0)

There are no reviews for Pinin Antibody (NBP1-87784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Pinin Antibody (NBP1-87784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNN