EFTUD2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EFTUD2 Antibody [NBP2-92930] - Analysis of C6 cells using EFTUD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: EFTUD2 Antibody [NBP2-92930] - Analysis of HeLa cells using EFTUD2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: EFTUD2 Antibody [NBP2-92930] - Analysis of L929 cells using EFTUD2 at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: EFTUD2 Antibody [NBP2-92930] - Analysis of EFTUD2 in paraffin-embedded rat brain tissue using EFTUD2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry-Paraffin: EFTUD2 Antibody [NBP2-92930] - Analysis of EFTUD2 in mouse brain tissue using EFTUD2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunoprecipitation: EFTUD2 Antibody - BSA Free [NBP2-92930] - Immunoprecipitation analysis of 300 ug extracts of NTH-3T3 cells using 3 ug EFTUD2 Rabbit pAb . Western blot was performed from the immunoprecipitate using EFTUD2 Rabbit pAb at a dilition of 1:2000.

Western Blot: EFTUD2 Antibody - BSA Free [NBP2-92930] - Western blot analysis of various lysates, using EFTUD2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EFTUD2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EFTUD2 Antibody - BSA Free (NBP2-92930) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human EFTUD2 (NP_004238.3). MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFTUD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 109 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EFTUD2 Antibody - BSA Free

• DKFZp686E24196
• elongation factor Tu GTP binding domain containing 2
• Elongation factor Tu GTP-binding domain-containing protein 2
• FLJ44695
• hSNU114
• KIAA0031U5-116 kDa
• SNRP116
• Snrp116,116 kDa U5 small nuclear ribonucleoprotein component
• SNU114 homolog
• Snu114
• U5 snRNP specific protein, 116 kD
• U5 snRNP-specific protein, 116 kD
• U5 snRNP-specific protein, 116 kDa
• U5-116KD

Background

EFTUD2 is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle, which is a component of the spliceosome. It contains consensus GTPase motifs, and it has been shown that this protein binds GTP specifically.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFTUD2