Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, Simple Western, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG |
Specificity | Specificity of human CREB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CREB1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. CREB antibody validated for Simple Western from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2), 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-90364 | Applications | Species |
---|---|---|
Bullen JW, Tchernyshyov I, Holewinski RJ et al. Protein kinase A-dependent phosphorylation stimulates the transcriptional activity of hypoxia-inducible factor 1 Sci Signal 2016 May 31 [PMID: 27245613] (WB, Human) | WB | Human |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
WB | Mouse | 10/11/2019 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Agnès Tessier |
Simple Western | Human | 06/17/2019 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Irini Dijkhoff |
Simple Western | Human | 05/24/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for CREB Antibody (NBP1-90364)Discover more about diseases related to CREB Antibody (NBP1-90364).
| Pathways for CREB Antibody (NBP1-90364)View related products by pathway.
|
PTMs for CREB Antibody (NBP1-90364)Learn more about PTMs related to CREB Antibody (NBP1-90364).
|
Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ... Read full blog post. |
Exploring the Many Roles of PGC-1 alpha The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Anonymous 10/11/2019 |
||
Application: | WB | |
Species: | Mouse |
Agnès Tessier 06/17/2019 |
||
Application: | Simple Western | |
Species: | Human |
Irini Dijkhoff 05/24/2019 |
||
Application: | Simple Western | |
Species: | Human |
Gene Symbol | CREB1 |