CREB Antibody

Images

 
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CREB Antibody [NBP1-90364] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Simple Western: CREB Antibody [NBP1-90364] - Human foreskin cell lysate. CREB antibody dilution of 1:50. Protein concentration is 750 ug/mL. Detection is chemiluminescence. Simple Western image submitted by a verified ...read more
Simple Western: CREB Antibody [NBP1-90364] - Detection of CREB by Simple Western (JESS) in reconstructed human epidermis lysate (about 600 ug/mL protein concentration). Antibody at 1:50. Simple Western image submitted ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. CREB antibody validated for Simple Western from a verified customer review.
Control Peptide
CREB Recombinant Protein Antigen (NBP1-90364PEP)
Reviewed Applications
Read 3 Reviews rated 4.7
using
NBP1-90364 in the following applications:

Publications
Read Publications using
NBP1-90364 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREB Antibody

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
DBD00
Species: Hu
Applications: ELISA
212-GD
Species: Hu
Applications: Bind, BA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
1310-SE
Species: Hu
Applications: EnzAct
MAB5285
Species: Hu
Applications: Simple Western, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB

Publications for CREB Antibody (NBP1-90364)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for CREB Antibody (NBP1-90364) (3) 4.73

Average Rating: 4.7
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-90364:
Filter by Applications
WB
(1)
Simple Western
(2)
All Applications
Filter by Species
Human
(2)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CREB NBP1-90364
Enlarge
5
reviewed by:
Verified Customer
WB Mouse 10/11/2019
View

Summary

ApplicationWestern Blot
Sample TestedEndothelial
SpeciesMouse
LotNONE ON TUBE
Simple Western CREB NBP1-90364
Enlarge
4
reviewed by:
Agnès Tessier
Simple Western Human 06/17/2019
View

Summary

ApplicationSimple Western
Sample TestedHuman foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
SpeciesHuman
LotR08246
Simple Western CREB NBP1-90364
Enlarge
5
reviewed by:
Irini Dijkhoff
Simple Western Human 05/24/2019
View

Summary

ApplicationSimple Western
Sample TestedHuman foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
SpeciesHuman
LotR08246

Comments

CommentsJESS default run settings.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CREB Antibody (NBP1-90364). (Showing 1 - 1 of 1 FAQs).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CREB Products

Bioinformatics Tool for CREB Antibody (NBP1-90364)

Discover related pathways, diseases and genes to CREB Antibody (NBP1-90364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB Antibody (NBP1-90364)

Discover more about diseases related to CREB Antibody (NBP1-90364).
 

Pathways for CREB Antibody (NBP1-90364)

View related products by pathway.

PTMs for CREB Antibody (NBP1-90364)

Learn more about PTMs related to CREB Antibody (NBP1-90364).

Blogs on CREB.

Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis
By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ...  Read full blog post.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.7
5
2
4
1
3
0
2
0
1
0

Verified Customer
10/11/2019
Application: WB
Species: Mouse

Agnès Tessier
06/17/2019
Application: Simple Western
Species: Human

Irini Dijkhoff
05/24/2019
Application: Simple Western
Species: Human

Bioinformatics

Gene Symbol CREB1