CREB Antibody

Images

 
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CREB Antibody [NBP1-90364] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CREB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CREB Recombinant Protein Antigen (NBP1-90364PEP)
Publications
Read Publication using
NBP1-90364 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREB Antibody

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1310
Species: Hu
Applications: WB, IHC, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NBP1-90364
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CREB Antibody (NBP1-90364)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CREB Antibody (NBP1-90364) (0)

There are no reviews for CREB Antibody (NBP1-90364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CREB Antibody (NBP1-90364). (Showing 1 - 1 of 1 FAQ).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Secondary Antibodies

 

Isotype Controls

Additional CREB Products

Bioinformatics Tool for CREB Antibody (NBP1-90364)

Discover related pathways, diseases and genes to CREB Antibody (NBP1-90364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB Antibody (NBP1-90364)

Discover more about diseases related to CREB Antibody (NBP1-90364).
 

Pathways for CREB Antibody (NBP1-90364)

View related products by pathway.

PTMs for CREB Antibody (NBP1-90364)

Learn more about PTMs related to CREB Antibody (NBP1-90364).

Blogs on CREB.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB1
Entrez