CREB Antibody - BSA Free

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-CREB1 (NBP1-90364) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Simple Western: CREB Antibody [NBP1-90364] - Human foreskin cell lysate. CREB antibody dilution of 1:50. Protein concentration is 750 ug/mL. Detection is chemiluminescence. Simple Western image submitted by a verified customer review.

Simple Western: CREB Antibody [NBP1-90364] - Detection of CREB by Simple Western (JESS) in reconstructed human epidermis lysate (about 600 ug/mL protein concentration). Antibody at 1:50. Simple Western image submitted by a verified customer review.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CREB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CREB Antibody - BSA Free (NBP1-90364) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-CREB Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CREB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in Human foreskin cell lysate, human epidermis lysate, separated by Size, antibody dilution of 1:50
• Control Peptide:

  CREB Recombinant Protein Antigen (NBP1-90364PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CREB Antibody - BSA Free

• active transcription factor CREB
• cAMP responsive element binding protein 1
• cAMP-response element-binding protein-1
• cAMP-responsive element-binding protein 1
• CREB
• CREB1
• CREB-1
• cyclic AMP-responsive element-binding protein 1
• MGC9284
• transactivator protein

Background

CREB (cAMP responsive element binding protein 1) stimulates transcription. CREB is involved in learning and memory. This protein is known to have interactions with HIST1H3B, HIST1h3A, HIST1H3C, HIST1H3D and HIST1H3E. CREB has been studied in relation to several diseases and disorders including Rubinstein-Taybi syndrome, Alzheimer's disease, leukemia and brain disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CREB Antibody (NBP1-90364)(3)

Publications using NBP1-90364

• Kim JE, Lee DS, Park H et al. Inhibition of AKT/GSK3?/CREB Pathway Improves the Responsiveness to AMPA Receptor Antagonists by Regulating GRIA1 Surface Expression in Chronic Epilepsy Rats Biomedicines 2021-04-14 [PMID: 33919872] (Western Blot, Human)
• Kim JE, Lee DS, Park H, Kang TC Src/CK2/PTEN-Mediated GluN2B and CREB Dephosphorylations Regulate the Responsiveness to AMPA Receptor Antagonists in Chronic Epilepsy Rats International journal of molecular sciences 2020-12-17 [PMID: 33348808] (WB, Rat)
• Bullen JW, Tchernyshyov I, Holewinski RJ et al. Protein kinase A-dependent phosphorylation stimulates the transcriptional activity of hypoxia-inducible factor 1 Sci Signal 2016-05-31 [PMID: 27245613] (WB, Human)

Reviews for CREB Antibody (NBP1-90364) (3)

Average Rating: 4.7

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Mouse.

reviewed by: Verified Customer WB Mouse 10/11/2019

Summary

• Application: Western Blot
• Sample Tested: Endothelial
• Species: Mouse
• Lot: NONE ON TUBE

reviewed by: Agnès Tessier Simple Western Human 06/17/2019

Summary

• Application: Simple Western
• Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
• Species: Human
• Lot: R08246

reviewed by: Irini Dijkhoff Simple Western Human 05/24/2019

Summary

• Application: Simple Western
• Sample Tested: Human foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
• Species: Human
• Lot: R08246

Comments

• Comments: JESS default run settings.

FAQs for CREB Antibody (NBP1-90364). (Showing 1 - 1 of 1 FAQs).

1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
   • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Bioinformatics

• Gene Symbol: CREB1