Home » CREB » CREB Antibodies » CREB Antibody

CREB Antibody

 (2 Publications)
 (3 Reviews)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CREB Antibody [NBP1-90364] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CREB Antibody [NBP1-90364] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Western Blot: CREB Antibody [NBP1-90364] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Simple Western: CREB Antibody [NBP1-90364] - Human foreskin cell lysate. CREB antibody dilution of 1:50. Protein concentration is 750 ug/mL. Detection is chemiluminescence. Simple Western image submitted by a verified ...read more
Simple Western: CREB Antibody [NBP1-90364] - Detection of CREB by Simple Western (JESS) in reconstructed human epidermis lysate (about 600 ug/mL protein concentration). Antibody at 1:50. Simple Western image submitted ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CREB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. CREB antibody validated for Simple Western from a verified customer review.
Control Peptide
CREB Recombinant Protein Antigen (NBP1-90364PEP)
Reviewed Applications
Read 3 Reviews rated 4.7
using
NBP1-90364 in the following applications:
Publications
Read Publications using
NBP1-90364 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CREB Antibody

  • active transcription factor CREB
  • cAMP responsive element binding protein 1
  • cAMP-response element-binding protein-1
  • cAMP-responsive element-binding protein 1
  • CREB
  • CREB1
  • CREB-1
  • cyclic AMP-responsive element-binding protein 1
  • MGC9284
  • transactivator protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
BDNF [HRP]
DBD00
(4 Reviews)
(62 Publications)
Species: Hu
Applications: ELISA
GDNF [Unconjugated]
212-GD
Recombinant Human GDNF (Catalog # 212‑GD) induces SH-SY5Y human neuroblastoma cell proliferation in the presence of Recombinant Human GFR alpha ‑1 Fc Chimera (Catalog # 714‑GR). The activity is approximately 9-fold greater than the top competitor's GDNF.
1 μg/lane of Recombinant Human GDNF was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 17 kDa and 34 kDa, respectively.
(4 Reviews)
(127 Publications)
Species: Hu
Applications: Bind, BA
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(35 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
FosB/G0S3 Antibody
(83B1138)
NB100-56530
Western Blot: FosB/G0S3 Antibody (83B1138) [NB100-56530] - Analysis of FosB in HeLa cell lysate where bands are observed at ~38 kDa representing FosB and at ~35 kDa representing delta FosB.
Species: Hu
Applications: WB
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(25 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Recombinant Human u-Plasminogen Activator/Urokinase (Catalog # 1310-SE) is measured by its ability to cleave a peptide substrate,N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC).
(10 Publications)
Species: Hu
Applications: EnzAct
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PAG1 at approximately 76 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PAG1 Monoclonal Antibody (Catalog # MAB5285). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Human PAG1 Polyclonal Antibody (Catalog # MAB5285) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PAG1 at approximately 70-85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
MCG10 Antibody
NBP1-76729
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml
Species: Hu, Mu
Applications: WB

Publications for CREB Antibody (NBP1-90364)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for CREB Antibody (NBP1-90364) (3) 4.73

Average Rating: 4.7
(Based on 3 reviews)
We have 3 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-90364:
Filter by Applications
WB
(1)
Simple Western
(2)
All Applications
Filter by Species
Human
(2)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CREB NBP1-90364
Enlarge 		5
reviewed by:
Verified Customer
 WB Mouse 10/11/2019
View

Summary

ApplicationWestern Blot
Sample TestedEndothelial
SpeciesMouse
LotNONE ON TUBE
Simple Western CREB NBP1-90364
Enlarge 		4
reviewed by:
Agnès Tessier
 Simple Western Human 06/17/2019
View

Summary

ApplicationSimple Western
Sample TestedHuman foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
SpeciesHuman
LotR08246
Simple Western CREB NBP1-90364
Enlarge 		5
reviewed by:
Irini Dijkhoff
 Simple Western Human 05/24/2019
View

Summary

ApplicationSimple Western
Sample TestedHuman foreskin, adult ski, engineered human skin, keratinocytes, HaCaT cells
SpeciesHuman
LotR08246

Comments

CommentsJESS default run settings.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CREB Antibody (NBP1-90364). (Showing 1 - 1 of 1 FAQs).

  1. May I know which creb1 antibody is good for ChIP? I found a paper using your rabbit polyclonal creb1 antibody for ChIP but they didn't indicate the catalog number.
    • We are not aware of any of our Creb1 antibodies being used in ChIP at this time. If you can provide us with the PMID of the paper you are referring to I can contact the author. Otherwise, you can use our Innovators Reward Program to try an antibody in a novel species and application.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CREB Products

Bioinformatics Tool for CREB Antibody (NBP1-90364)

Discover related pathways, diseases and genes to CREB Antibody (NBP1-90364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB Antibody (NBP1-90364)

Discover more about diseases related to CREB Antibody (NBP1-90364).
 

Pathways for CREB Antibody (NBP1-90364)

View related products by pathway.

PTMs for CREB Antibody (NBP1-90364)

Learn more about PTMs related to CREB Antibody (NBP1-90364).

Blogs on CREB.

Check out the latest blog posts on CREB.
Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysis
By Rosa Moreno, PhD. Detecting HIF alpha and beyond: Best controls for hypoxia Western blot analysisPhysiological low levels of oxygen induce normal hypoxic events across biological systems. This hypoxic state activ...  Read full blog post.
Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.7
5
2
4
1
3
0
2
0
1
0
Western Blot CREB NBP1-90364
Enlarge
 Verified Customer
10/11/2019
Application: WB
Species: Mouse
read this review
Simple Western CREB NBP1-90364
Enlarge
 Agnès Tessier
06/17/2019
Application: Simple Western
Species: Human
read this review
Simple Western CREB NBP1-90364
Enlarge
 Irini Dijkhoff
05/24/2019
Application: Simple Western
Species: Human
read this review

Bioinformatics

Gene Symbol CREB1