We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SREBP1 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: SREBP1 Antibody [NBP2-76535] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.
ChIP-Exo-Seq composite graph for Anti-SREBP1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SREBP1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SREBF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86)% and Rat (84)%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SREBP1 Antibody - BSA Free

  • bHLHd1
  • Class D basic helix-loop-helix protein 1
  • SREBF1
  • SREBP 1c
  • SREBP1
  • SREBP-1
  • SREBP1bHLHd1SREBP-1c
  • sterol regulatory element binding protein-1
  • sterol regulatory element binding transcription factor 1
  • sterol regulatory element-binding protein 1
  • Sterol regulatory element-binding transcription factor 1

Background

SREBP (Sterol Regulatory Element Binding Protein) 1 and 2 are transcription factors which participate in the control of cholesterol homeostasis. SREBP proteins, which are attached to the endoplasmic reticulum and nuclear envelope, are proteolytically cleaved and thus activated in response to conditions of low cellular sterol. SREBPs may also play some role in the apoptotic processes.

SREBP1 is a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-74543
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-92206
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB100-55246
Species: Hu
Applications: IP, WB (-)
AF7550
Species: Hu
Applications: IP, KO, WB
DLP00
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NB400-135
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PAGE, WB
NBP2-76535
Species: Hu
Applications: ICC/IF, ChIP

Publications for SREBP1 Antibody (NBP2-76535) (0)

There are no publications for SREBP1 Antibody (NBP2-76535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREBP1 Antibody (NBP2-76535) (0)

There are no reviews for SREBP1 Antibody (NBP2-76535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SREBP1 Antibody (NBP2-76535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SREBP1 Products

Research Areas for SREBP1 Antibody (NBP2-76535)

Find related products by research area.

Blogs on SREBP1.

Metabolic Syndrome: Symptoms and associated disease states
By Jamshed Arslan, Pharm. D., PhD. What is metabolic syndrome?It was 1988 when, after decades of research, Dr. GM Reaven    of the Stanford University, CA, explained the relationship between four diseases:...  Read full blog post.

SREBP2 - regulating cholesterol homeostasis and lipid metabolism
Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SREBP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SREBF1