SRC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SRC1 Antibody [NBP2-57610] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL
Specificity
Specificity of human SRC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCOA1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SRC1 Recombinant Protein Antigen (NBP2-57610PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SRC1 Antibody

  • bHLHe42
  • BHLHE74
  • Class E basic helix-loop-helix protein 74
  • EC 2.3.1.48
  • Hin-2 protein
  • KAT13A
  • MGC129719
  • NCoA-1
  • nuclear receptor coactivator 1
  • PAX3/NCOA1 fusion protein
  • Protein Hin-2
  • Renal carcinoma antigen NY-REN-52
  • RIP160bHLHe74F-SRC-1
  • SRC-1
  • SRC1MGC129720
  • Steroid receptor coactivator 1
  • steroid receptor coactivator-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NB100-61050
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-51531
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-37537
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N

Publications for SRC1 Antibody (NBP2-57610) (0)

There are no publications for SRC1 Antibody (NBP2-57610).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRC1 Antibody (NBP2-57610) (0)

There are no reviews for SRC1 Antibody (NBP2-57610). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SRC1 Antibody (NBP2-57610) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SRC1 Products

Bioinformatics Tool for SRC1 Antibody (NBP2-57610)

Discover related pathways, diseases and genes to SRC1 Antibody (NBP2-57610). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRC1 Antibody (NBP2-57610)

Discover more about diseases related to SRC1 Antibody (NBP2-57610).
 

Pathways for SRC1 Antibody (NBP2-57610)

View related products by pathway.

PTMs for SRC1 Antibody (NBP2-57610)

Learn more about PTMs related to SRC1 Antibody (NBP2-57610).
 

Research Areas for SRC1 Antibody (NBP2-57610)

Find related products by research area.

Blogs on SRC1

There are no specific blogs for SRC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA1