NCOA3/AIB1 Antibody - BSA Free

Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli and cells in tubules.

Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human lymph node shows strong nuclear positivity in germinal center and non-germinal center cells.

Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7

ChIP-Exo-Seq composite graph for Anti-NCOA3 (NBP1-90256) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCOA3/AIB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCOA3/AIB1 Antibody - BSA Free (NBP1-90256) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NCOA3/AIB1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCOA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NCOA3/AIB1 Recombinant Protein Antigen (NBP1-90256PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCOA3/AIB1 Antibody - BSA Free

• ACTR
• ACTRCBP-interacting protein
• AIB1
• AIB1AIB-1
• Amplified in breast cancer 1 protein
• BHLHE42
• bHLHe42p/CIP
• CAGH16
• Class E basic helix-loop-helix protein 42
• CTG26
• KAT13B
• MGC141848
• NCOA3
• NCoA-3
• nuclear receptor coactivator 3
• pCIP
• pCIP
• RAC3
• RAC-3
• RAC3pCIP
• Receptor-associated coactivator 3
• SRC-1
• SRC3
• SRC-3
• SRC-3EC 2.3.1.48
• Steroid receptor coactivator protein 3
• Thyroid hormone receptor activator molecule 1
• TNRC16
• TRAM1
• TRAM-1TNRC14

Background

NCOA3/SRC3 (nuclear receptor coactivator 3/steroid receptor coactivator 3 (SRC3)) is a 155 kD member of the p160/steroid receptor coactivator family containing a nuclear localization sequence, bHLH, and PAS domain. There are two reported isoforms of this protein. NCOA3/SRC3 is localized mainly in the cytoplasm, with weak nuclear expression. The protein is translocated to the nucleus upon phosphorylation. NCOA3/SRC3 is widely expressed with high expression in the heart, skeletal muscle, pancreas, and placenta and low expression in the brain. NCOA3/SRC3 is expressed at very low levels in the lung, liver, and kidney and overexpressed in breast and ovarian cancers. This protein has histone acetyltransferase activity and functions as a transcriptional coactivator for steroid and nuclear hormone receptors. Phosphorylation by I kappaB kinase enhances coactivator function. Acetylation by CREB-BP disrupts interaction with nuclear receptors. NCOA3/SRC3 forms a multisubunit coactivation complex with NCOA2 IKKA, IKKB, IKBKG and histone acetyltransferase protein CREB binding protein and has also been shown to interact with PCAF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NCOA3/AIB1 Antibody (NBP1-90256)(1)

Publication using NBP1-90256

• Maxime Battistella, Martha Romero, Luis-Jaime Castro-Vega et al. The High Expression of the microRNA 17-92 Cluster and its Paralogs, and the Downregulation of the Target Gene PTEN, Is Associated with Primary Cutaneous B-Cell Lymphoma Progression. Journal of Investigative Dermatology 2015-01-29 [PMID: 25634356] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: NCOA3
• Entrez:
  • 8202(Human)
• Uniprot:
  • Q9Y6Q9()