Home » NCOA3/AIB1 » AIB1 Research Products » NCOA3/AIB1 Antibody

NCOA3/AIB1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NCOA3/AIB1 Antibody [NBP1-90256] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
Western Blot: NCOA3/AIB1 Antibody [NBP1-90256] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
Immunocytochemistry/ Immunofluorescence: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli and cells in tubules.
Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human lymph node shows strong nuclear positivity in germinal center and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NCOA3/AIB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL
Specificity
Specificity of human NCOA3/AIB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCOA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-90256 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%). Human reactivity reported in scientific literature (PMID: 25634356).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCOA3/AIB1 Antibody

  • ACTR
  • ACTRCBP-interacting protein
  • AIB1
  • AIB1AIB-1
  • Amplified in breast cancer 1 protein
  • BHLHE42
  • bHLHe42p/CIP
  • CAGH16
  • Class E basic helix-loop-helix protein 42
  • CTG26
  • KAT13B
  • MGC141848
  • NCOA3
  • NCoA-3
  • nuclear receptor coactivator 3
  • pCIP
  • pCIP
  • RAC3
  • RAC-3
  • RAC3pCIP
  • Receptor-associated coactivator 3
  • SRC-1
  • SRC3
  • SRC-3
  • SRC-3EC 2.3.1.48
  • Steroid receptor coactivator protein 3
  • Thyroid hormone receptor activator molecule 1
  • TNRC16
  • TRAM1
  • TRAM-1TNRC14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP
NCOA2 Antibody
NB100-1756
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of prostate adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:100. Detection : DAB
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Samples: FFPE sections of human breast adenocarcinoma (upper image) and prostate adenocarcinoma (lower image). Antibody: Affinity purified rabbit anti-SRC2 NB100-1756 used at a dilution of 1:100. Detection: DAB
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of human breast adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:250. Detection : DAB
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IP
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Av, Bv, Ge, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
SRA1 Antibody
(1D4H8)
NBP1-51531
Western Blot: SRA1 Antibody (1D4H8) [NBP1-51531] - Analysis using SRA mouse mAb against truncated SRA recombinant protein (1), human ovary cancer tissue lysate (2) and A431 cell lysate (3).
Immunohistochemistry-Paraffin: SRA1 Antibody (1D4H8) [NBP1-51531] - Analysis of human skin carcinoma (left) and breast carcinoma (right), showing cytoplasmic and membrane localization using SRA mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
PELP1 Antibody
NB200-331
Western Blot: PELP1 Antibody [NB200-331] - Detection of mouse PELP1/MNAR by western blot. Samples: Whole cell lysate (50 ug) from NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PELP1/MNAR antibody NB200-331 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry: PELP1 Antibody [NB200-331] - Samples: FFPE sections of human ovarian carcinoma.~ Antibodies: Affinity purified rabbit anti-PELP1/MNAR ~Cat. No. Lot2 used at a dilution of 1:2,500 (0.4ug/ml) (left) and Cat. No. Lot3 used at a dilution of 1:5,000 (0.2ug/ml) (right). Detection: DAB.
Western Blot: PELP1 Antibody [NB200-331] - Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-PELP1 antibody NB200-331 lot number 2 used for WB at 0.04 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate (B). PELP1 was also immunoprecipitated by previous lot 1 of this antibody. Detection: Chemiluminescence with exposure times of 10 second (A) and 3 seconds (B).
(18 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MYBBP1A Antibody
NB100-61050
Immunohistochemistry-Paraffin: MYBBP1A Antibody [NB100-61050] - Human colon carcinoma. Antibody: Affinity purified rabbit anti-MYBBP1A used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MYBBP1A Antibody [NB100-61050] - Detection of human MYBBP1A by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MYBBP1A antibody NB100-61050 used for IP at 3 ug per reaction. MYBBP1A was also immunoprecipitated by rabbit anti-MYBBP1A antibody NB100-61051. For blotting immunoprecipitated MYBBP1A, NB100-61051 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MSH6 Antibody (3E1)
NBP2-37537
Western Blot: MSH6 Antibody (3E1) [NBP2-37537] - Western blot analysis using MSH6 mouse mAb against HEK293 (1), HCT116 (2), A549 (3), A431 (4), MCF-7 (5) and HepG2 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: MSH6 Antibody (3E1) [NBP2-37537] - Immunofluorescence analysis of Hela cells using MSH6 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: MSH6 Antibody (3E1) [NBP2-37537] - Analysis of colon cancer tissues using MSH6 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
KAT3B/p300
Antibody (RW105)
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
MCG10 Antibody
NBP1-76729
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Human PAG1 Polyclonal Antibody (Catalog # MAB5285) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PAG1 at approximately 70-85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PAG1 at approximately 76 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PAG1 Monoclonal Antibody (Catalog # MAB5285). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu
Applications: WB, Simple Western
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Progesterone
R/NR3C3 Antibody (Alp ...
NB120-2765
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (Alpha PR6) [NB120-2765] - Staining of human uterus tissue.
(1 Publication)
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(38 Publications)
Species: Hu

Publications for NCOA3/AIB1 Antibody (NBP1-90256)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NCOA3/AIB1 Antibody (NBP1-90256) (0)

There are no reviews for NCOA3/AIB1 Antibody (NBP1-90256). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCOA3/AIB1 Antibody (NBP1-90256) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NCOA3/AIB1 Products

Bioinformatics Tool for NCOA3/AIB1 Antibody (NBP1-90256)

Discover related pathways, diseases and genes to NCOA3/AIB1 Antibody (NBP1-90256). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA3/AIB1 Antibody (NBP1-90256)

Discover more about diseases related to NCOA3/AIB1 Antibody (NBP1-90256).
 

Pathways for NCOA3/AIB1 Antibody (NBP1-90256)

View related products by pathway.

PTMs for NCOA3/AIB1 Antibody (NBP1-90256)

Learn more about PTMs related to NCOA3/AIB1 Antibody (NBP1-90256).
 

Research Areas for NCOA3/AIB1 Antibody (NBP1-90256)

Find related products by research area.

Blogs on NCOA3/AIB1

There are no specific blogs for NCOA3/AIB1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCOA3/AIB1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA3
Entrez
Uniprot
Novus 100% Guarantee