Home » NCOA3/AIB1 » NCOA3/AIB1 Antibodies » NCOA3/AIB1 Antibody

NCOA3/AIB1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NCOA3/AIB1 Antibody [NBP1-90256] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
Western Blot: NCOA3/AIB1 Antibody [NBP1-90256] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MCF-7
Immunocytochemistry/ Immunofluorescence: NCOA3/AIB1 Antibody [NBP1-90256] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: NCOA3/AIB1 Antibody [NBP1-90256] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NCOA3/AIB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLL
Specificity
Specificity of human NCOA3/AIB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCOA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCOA3/AIB1 Protein (NBP1-90256PEP)
Publications
Read Publication using
NBP1-90256 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%). Human reactivity reported in scientific literature (PMID: 25634356).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCOA3/AIB1 Antibody

  • ACTR
  • ACTRCBP-interacting protein
  • AIB1
  • AIB1AIB-1
  • Amplified in breast cancer 1 protein
  • BHLHE42
  • bHLHe42p/CIP
  • CAGH16
  • Class E basic helix-loop-helix protein 42
  • CTG26
  • KAT13B
  • MGC141848
  • NCOA3
  • NCoA-3
  • nuclear receptor coactivator 3
  • pCIP
  • pCIP
  • RAC3
  • RAC-3
  • RAC3pCIP
  • Receptor-associated coactivator 3
  • SRC-1
  • SRC3
  • SRC-3
  • SRC-3EC 2.3.1.48
  • Steroid receptor coactivator protein 3
  • Thyroid hormone receptor activator molecule 1
  • TNRC16
  • TRAM1
  • TRAM-1TNRC14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Sample (50 ug of whole cell lysate) A: Mouse brain 5% SDS PAGE, antibody diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NCOA2 Antibody
NB100-1756
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of human breast adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:250. Detection : DAB
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Samples: FFPE sections of human breast adenocarcinoma (upper image) and prostate adenocarcinoma (lower image). Antibody: Affinity purified rabbit anti-SRC2 NB100-1756 used at a dilution of 1:100. Detection: DAB
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of prostate adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:100. Detection : DAB
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Proximity Ligation Assay: CBP/KAT3A Antibody [NB100-381] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human ATM (NB100-271) and rabbit anti-human CBP (NB100-381). Image merged from DAPI (2ms) and Texs Red (200ms) exposures, 40X magnification.
Proximity Ligation Assay: CBP/KAT3A Antibody [NB100-381] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human SMARCA4 (NBP2-22234) and rabbit anti-human CBP (NB100-381). Image merged from DAPI (2ms) and Texs Red (200ms) exposures, 40X magnification.
(2 Reviews)
Species: Hu
Applications: WB, ChIP, IP, PLA
ER alpha/NR3A1
Antibody (EVG F9)
NB100-74413
Western Blot: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of various whole cell lysates.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of Estrogen Receptor alpha using Anti-Estrogen Receptor alpha Monoclonal Antibody (EVG F9) shows staining in U251 Cells. Estrogen Receptor alpha staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Estrogen Receptor alpha at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Cancer biopsies of deparaffinized Human breast carcinoma tissues.
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
SRA1 Antibody
NBP2-47260
Immunocytochemistry/Immunofluorescence: SRA1 Antibody [NBP2-47260] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SRA1 Antibody [NBP2-47260] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PELP1 Antibody
NB200-331
Western Blot: PELP1 Antibody [NB200-331] - Detection of Human PELP1/MNAR by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PELP1/MNAR antibody NB200-331 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Immunohistochemistry: PELP1 Antibody [NB200-331] - Samples: FFPE sections of human ovarian carcinoma.~ Antibodies: Affinity purified rabbit anti-PELP1/MNAR ~Cat. No. Lot2 used at a dilution of 1:2,500 (0.4ug/ml) (left) and Cat. No. Lot3 used at a dilution of 1:5,000 (0.2ug/ml) (right). Detection: DAB.
Western Blot: PELP1 Antibody [NB200-331] - Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-PELP1 antibody NB200-331 lot number 2 used for WB at 0.04 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate (B). PELP1 was also immunoprecipitated by previous lot 1 of this antibody. Detection: Chemiluminescence with exposure times of 10 second (A) and 3 seconds (B).
(18 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MYBBP1A Antibody
NB100-61050
Immunohistochemistry: MYBBP1A Antibody [NB100-61050] - Sample: FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti- MYBBP1a used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MYBBP1A Antibody [NB100-61050] - Detection of Human MYBBP1a by Western Blot of Immunoprecipitates. Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-MYBBP1a antibody NB100-61050 used for IP at 3 mcg/mg lysate. MYBBP1a was also immunoprecipitated by rabbit anti-MYBBP1a antibody NB100-61051, which recognizes a downstream epitope.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MSH6 Antibody
NB100-328
Western Blot: MSH6 Antibody [NB100-328] - Detection of Human MSH6 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified goat anti-MSH6 antibody NB100-328 used for WB at 0.5 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: MSH6 Antibody [NB100-328] - Sample: FFPE section of human non-small cell lung cancer. Antibody: Affinity purified rabbit anti-MSH6 used at a dilution of 1:500 (2ug/ml). Detection: DAB
Western Blot: MSH6 Antibody [NB100-328] - Sample: Whole cell lysate (50 ug for WB; 1 mg for IP) from HeLa (A) and HCT116 3-6 (B) cells. Antibodies: Affinity purified goat anti-MSH6 used at 1 ug/ml for WB (A) and 1 ug/mg lysate for IP (B). For IP/WB (B), MSH6 was detected using a monoclonal antibody to MSH6. Detection: Chemiluminescence with 1 min exposure.
(2 Publications)
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP, PLA
KAT3B/p300
Antibody (RW105)
NB100-616
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-KAT3B/p300 (RW105) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow (Intracellular): KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(8 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
MCG10 Antibody
NBP1-76729
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PAG1 Antibody
(PAG-C1)
NB500-487
Immunohistochemistry-Paraffin: PAG1 Antibody (PAG-C1) [NB500-487] - staining (paraffin sections) of PAG/Cbp in germinal center of lymphatic follicle and in dispersed T cells in appendix tissue by monoclonal antibody PAG-C1. Positive signal in T cells.
Immunoprecipitation: PAG1 Antibody (PAG-C1) [NB500-487] - Immunoprecipitation of human Cbp/PAG from the lysate of RAJI human Burkitt lymphoma cell line. Western blot was immunostained with anti-human Cbp/PAG (MEM-255). Note: Csk-binding protein (Cbp/PAG) is a 46 kDa adaptor protein, which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Lane 1,2: immunoprecipitation with anti-Cbp/PAG (PAG-C1) Lane 3: immunoprecipitation with anti-Cbp/PAG (polyclonal antibody).
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Opsin 1 (Long
Wave) RNAi
H00005956-R02
Species: Hu
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(5 Reviews)
(26 Publications)
Species: Hu
NCOA3/AIB1 Antibody
NBP1-90256
NCOA3/AIB1 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NCOA3/AIB1 Antibody (NBP1-90256)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NCOA3/AIB1 Antibody (NBP1-90256) (0)

There are no reviews for NCOA3/AIB1 Antibody (NBP1-90256). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCOA3/AIB1 Antibody (NBP1-90256) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCOA3/AIB1 Products

Bioinformatics Tool for NCOA3/AIB1 Antibody (NBP1-90256)

Discover related pathways, diseases and genes to NCOA3/AIB1 Antibody (NBP1-90256). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA3/AIB1 Antibody (NBP1-90256)

Discover more about diseases related to NCOA3/AIB1 Antibody (NBP1-90256).
 

Pathways for NCOA3/AIB1 Antibody (NBP1-90256)

View related products by pathway.

PTMs for NCOA3/AIB1 Antibody (NBP1-90256)

Learn more about PTMs related to NCOA3/AIB1 Antibody (NBP1-90256).
 

Research Areas for NCOA3/AIB1 Antibody (NBP1-90256)

Find related products by research area.

Blogs on NCOA3/AIB1

There are no specific blogs for NCOA3/AIB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCOA3/AIB1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA3
Entrez
Uniprot