MSH6 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MSH6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MSH6 Antibody - BSA Free
Background
MSH6 is a mismatch-repair protein. It plays a role in tumor suppression. Genomic mutations in MSH6 predispose to the hereditary non-polyposis colorectal cancer (HNPCC) syndrome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Publications for MSH6 Antibody (NBP1-83319) (0)
There are no publications for MSH6 Antibody (NBP1-83319).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MSH6 Antibody (NBP1-83319) (0)
There are no reviews for MSH6 Antibody (NBP1-83319).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MSH6 Antibody (NBP1-83319). (Showing 1 - 1 of 1 FAQ).
-
I am testing a mouse sample with human xenograft for GBM and I am looking for an MSH6 Antibody that will only detect the human cells.
- Currently, we have no validation that any of our MSH6 antibodies will not cross react with mouse. All of our MSH6 Antibodies are raised against Human MSH6 so we have checked the % homology with mouse MSH6 which has come to be 85%. As 85% is very high, the chances of the antibody detecting the mouse tissue as well as the human tissue are high.
Secondary Antibodies
| |
Isotype Controls
|
Additional MSH6 Products
Research Areas for MSH6 Antibody (NBP1-83319)
Find related products by research area.
|
Blogs on MSH6