MSH6 Antibody


Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: MSH6 Antibody [NBP1-83319] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human lymph node shows strong nuclear positivity in reaction center cells.
Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MSH6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV
Specificity of human, mouse, rat MSH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
MSH6 Lysate (NBP2-64905)
Control Peptide
MSH6 Protein (NBP1-83319PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MSH6 Antibody

  • DNA mismatch repair protein Msh6
  • G/T mismatch-binding protein
  • hMSH6
  • HSAP
  • mutS (E. coli) homolog 6
  • mutS homolog 6 (E. coli)
  • MutS-alpha 160 kDa subunit
  • p160
  • sperm-associated protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MSH6 Antibody (NBP1-83319) (0)

There are no publications for MSH6 Antibody (NBP1-83319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSH6 Antibody (NBP1-83319) (0)

There are no reviews for MSH6 Antibody (NBP1-83319). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MSH6 Antibody (NBP1-83319). (Showing 1 - 1 of 1 FAQ).

  1. I am testing a mouse sample with human xenograft for GBM and I am looking for an MSH6 Antibody that will only detect the human cells.
    • Currently, we have no validation that any of our MSH6 antibodies will not cross react with mouse. All of our MSH6 Antibodies are raised against Human MSH6 so we have checked the % homology with mouse MSH6 which has come to be 85%. As 85% is very high, the chances of the antibody detecting the mouse tissue as well as the human tissue are high.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional MSH6 Products

Bioinformatics Tool for MSH6 Antibody (NBP1-83319)

Discover related pathways, diseases and genes to MSH6 Antibody (NBP1-83319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSH6 Antibody (NBP1-83319)

Discover more about diseases related to MSH6 Antibody (NBP1-83319).

Pathways for MSH6 Antibody (NBP1-83319)

View related products by pathway.

PTMs for MSH6 Antibody (NBP1-83319)

Learn more about PTMs related to MSH6 Antibody (NBP1-83319).

Research Areas for MSH6 Antibody (NBP1-83319)

Find related products by research area.

Blogs on MSH6

There are no specific blogs for MSH6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MSH6 Antibody and receive a gift card or discount.


Gene Symbol MSH6