SRA1 Antibody - Azide and BSA Free

Western Blot: SRA1 Antibody - Azide and BSA Free [SRA1] - Western blot analysis of various lysates, using SRA1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SRA1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit SRA1 Antibody - Azide and BSA Free (NBP3-03922) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRA1 (NP_001030312.2). MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100 - 1:500
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for SRA1 Antibody - Azide and BSA Free

• MGC87674
• pp7684
• SRA
• SRAP
• steriod receptor RNA activator 1
• steriod receptor RNA activator protein
• steroid receptor coactivator
• steroid receptor RNA activator 1 (complexes with NCOA1)
• steroid receptor RNA activator 1
• Steroid receptor RNA activator protein
• STRAA1

Background

SRA1 is involved in transcriptional coactivation by steroid receptors. There is currently data suggesting this gene encodes both a non-coding RNA that functions as part of a ribonucleoprotein complex and a protein coding mRNA. Increased expression of both the transcript and the protein is associated with cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SRA1