SR-AI/MSR Antibody - BSA Free

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining in human lung and cerebral cortex tissues.. Corresponding MSR1 RNA-seq data are presented for the same tissues.

Western Blot: SR-AI/MSR Antibody [NBP1-88125] - Analysis in control (vector only transfected HEK293T lysate) and mSR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SR-AI/MSR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SR-AI/MSR Protein (NBP1-88125PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SR-AI/MSR Antibody - BSA Free

• CD204 antigen
• CD204
• Macrophage acetylated LDL receptor I and II
• macrophage scavenger receptor 1
• macrophage scavenger receptor type III
• MSR1
• phSR1
• phSR2
• SCARA1
• SCARA1macrophage scavenger receptor types I and II
• Scavenger receptor class A member 1
• scavenger receptor class A, member 1
• SR-A
• SRAI
• SR-AI

Background

Macrophage scavenger receptors (MSR) are membrane glycoproteins that mediate the recognition and uptake of a variety of macromolecules, including modified lipoproteins, advanced glycation end (AGEs) products and amyloid b-protein (Abeta). While the normal role of MSR is associated with cell adhesion and host defense mechanisms, it also has been implicated in the development of atherosclerosis and Abeta deposition in Alzheimer's disease (AD).

In cell cultures, macrophage scavenger receptor has been shown to mediate adhesion of macrophages and other cell lines to tissue culture plastic. MSR1 antibodies are useful for research on atherosclerosis, Alzheimer's disease, and host defense.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SR-AI/MSR Antibody (NBP1-88125)(1)

Publication using NBP1-88125

• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: MSR1
• Entrez:
  • 4481(Human)
• Uniprot:
  • P21757()