SR-AI/MSR Antibody

Images

 
Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Analysis in control (vector only transfected HEK293T lysate) and mSR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: SR-AI/MSR Antibody [NBP1-88125] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SR-AI/MSR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SR-AI/MSR Protein (NBP1-88125PEP)
Publications
Read Publication using NBP1-88125.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SR-AI/MSR Antibody

  • CD204 antigen
  • CD204
  • Macrophage acetylated LDL receptor I and II
  • macrophage scavenger receptor 1
  • macrophage scavenger receptor type III
  • MSR1
  • phSR1
  • phSR2
  • SCARA1
  • SCARA1macrophage scavenger receptor types I and II
  • Scavenger receptor class A member 1
  • scavenger receptor class A, member 1
  • SR-A
  • SRAI
  • SR-AI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-39004
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
795-P4/CF
Species: Hu
NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SR-AI/MSR Antibody (NBP1-88125)(1)

Reviews for SR-AI/MSR Antibody (NBP1-88125) (0)

There are no reviews for SR-AI/MSR Antibody (NBP1-88125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SR-AI/MSR Antibody (NBP1-88125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SR-AI/MSR Products

Bioinformatics Tool for SR-AI/MSR Antibody (NBP1-88125)

Discover related pathways, diseases and genes to SR-AI/MSR Antibody (NBP1-88125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SR-AI/MSR Antibody (NBP1-88125)

Discover more about diseases related to SR-AI/MSR Antibody (NBP1-88125).
 

Pathways for SR-AI/MSR Antibody (NBP1-88125)

View related products by pathway.

PTMs for SR-AI/MSR Antibody (NBP1-88125)

Learn more about PTMs related to SR-AI/MSR Antibody (NBP1-88125).
 

Research Areas for SR-AI/MSR Antibody (NBP1-88125)

Find related products by research area.

Blogs on SR-AI/MSR

There are no specific blogs for SR-AI/MSR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR-AI/MSR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSR1
Entrez
Uniprot