Sphingomyelin Synthase 2 Antibody - BSA Free

Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-60004] - Sphingomyelin Synthase 2 expression in mouse lung lysate using anti-Sphingomyelin Synthase 2 antibody. Image from verified customer review.

Western Blot: Sphingomyelin Synthase 2 Antibody [NBP1-60004] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Sphingomyelin Synthase 2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SGMS2(sphingomyelin synthase 2) The peptide sequence was selected from the N terminal of SGMS2. Peptide sequence KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGMS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Sphingomyelin Synthase 2 Antibody - BSA Free

• EC 2.7.8.27
• phosphatidylcholine:ceramide cholinephosphotransferase 2
• SM synthase
• sphingomyelin synthase 2SMS2MGC26963

Background

SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognizes the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. SGMS2 does not function strictly as a SM synthase. SGMS2 is required for cell growth.Sphingomyelin (SM) is a major component of plasma membranes. It is preferentially concentrated in the outer leaflet and has a role in the formation of lipid rafts. SM synthases (EC 2.7.8.27), such as SGMS2, produce SM in the lumen of the Golgi and on the cell surface through the transfer of phosphocholine from phosphatidylcholine onto ceramide, yielding diacylglycerol as a side product (Huitema et al., 2004 [PubMed 14685263]).[supplied by OMIM]. Sequence Note: removed 3 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2142 BC041369.2 4-2145

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Sphingomyelin Synthase 2 Antibody (NBP1-60004) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Wen Zhang WB Mouse 10/06/2014

Summary

• Application: Western Blot
• Sample Tested: mouse lung
• Species: Mouse

FAQs for Sphingomyelin Synthase 2 Antibody (NBP1-60004). (Showing 1 - 1 of 1 FAQ).

1. I am interested in your antibody anti-SMS2 cat no: NBP1-60004. Can this antibody recognize the extracellular part of SMS2 in non-permeablized cells by immunofluoresence?
   • Thank you for contacting Novus Biologicals regarding your interest in NBP1-60004. This antibody was made against a peptide immunogen, amino acids ~70-120. According to the uniprot entry Q8NHU3, the transmembrane region begins at position 80. We have only tested this antibody for western blot, so we are unsure how it would work for ICC.

Bioinformatics

• Gene Symbol: SGMS2
• Uniprot:
  • Q8NHU3(Human)