UGCG Antibody (1E5)

Images

 
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Detection of UGCG in HT29 human colon carcinoma cells. Image provided courtesy of Dr. James Madigan.
ELISA: UGCG Antibody (1E5.) [H00007357-M03] - UGCG Antibody (1E5) [H00007357-M03] - Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGCG Antibody (1E5) Summary

Immunogen
UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Specificity
Reacts with UDP-glucose ceramide glucosyltransferase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Reviewed Applications
Read 1 Review rated 5
using
H00007357-M03 in the following applications:

Publications
Read Publications using H00007357-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGCG Antibody (1E5)

  • ceramide glucosyltransferase
  • EC 2.4.1.80
  • GCS
  • GCSGLCT1
  • GLCT-1
  • Glucosylceramide synthase
  • UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase
  • UGCG

Background

Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF1049
Species: Hu
Applications: IHC, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45889
Species: Hu
Applications: IHC, IHC-Fr, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-84685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
D6050
Species: Hu
Applications: ELISA
NBP2-57177
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for UGCG Antibody (H00007357-M03)(3)

Review for UGCG Antibody (H00007357-M03) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007357-M03:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UGCG H00007357-M03
Enlarge
5
reviewed by:
James Madigan
Western Blot Human 04/17/2010
View

Summary

ApplicationWestern Blot
Sample TestedHT29 human colorectal carcinoma cells, Sample Amount: 40ug
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCG Antibody (H00007357-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGCG Products

Bioinformatics Tool for UGCG Antibody (H00007357-M03)

Discover related pathways, diseases and genes to UGCG Antibody (H00007357-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGCG Antibody (H00007357-M03)

Discover more about diseases related to UGCG Antibody (H00007357-M03).
 

Pathways for UGCG Antibody (H00007357-M03)

View related products by pathway.

PTMs for UGCG Antibody (H00007357-M03)

Learn more about PTMs related to UGCG Antibody (H00007357-M03).
 

Research Areas for UGCG Antibody (H00007357-M03)

Find related products by research area.

Blogs on UGCG

There are no specific blogs for UGCG, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

James Madigan
04/17/2010
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol UGCG
Entrez
Uniprot