Home » UGCG » UGCG Antibodies » UGCG Antibody (1E5)

UGCG Antibody (1E5)

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Detection of UGCG in HT29 human colon carcinoma cells. Image provided courtesy of Dr. James Madigan.
ELISA: UGCG Antibody (1E5.) [H00007357-M03] - UGCG Antibody (1E5) [H00007357-M03] - Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

UGCG Antibody (1E5) Summary

Immunogen
UGCG (NP_003349, 33 a.a. - 131 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Specificity
Reacts with UDP-glucose ceramide glucosyltransferase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Control
UGCG Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 5
using
H00007357-M03 in the following applications:
Publications
Read Publications using H00007357-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGCG Antibody (1E5)

  • ceramide glucosyltransferase
  • EC 2.4.1.80
  • GCSGLCT1
  • GLCT-1
  • Glucosylceramide synthase
  • UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase

Background

Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GCLC Antibody (3H1)
H00002729-M01
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: GCLC Antibody (3H1) [H00002729-M01] - Analysis of monoclonal antibody to GCLC on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: GCLC Antibody (3H1) [H00002729-M01] - GCLC monoclonal antibody (M01), clone 3H1. Analysis of GCLC expression in PC-12.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(26 Reviews)
(631 Publications)
Species: Hu
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Cathepsin A/Lysosomal Carboxypeptidase A was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Cathepsin A/Lysosomal Carboxypeptidase A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1049) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, IHC
GM-CSF
7954-GM/CF
GM-CSF
(1 Publication)
Species: Hu
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot: LAMC2 Antibody (CL2980) [NBP2-42388] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LAMC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining of A-431 cells using the Anti-LAMC2 monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: LAMC2 Antibody (CL2980) [NBP2-42388] - Staining in human fallopian tube and liver tissues. Corresponding LAMC2 RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Glutathione
Reductase Antibody
NBP2-16684
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione Reductase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Glutathione Reductase Antibody [NBP2-16684] - Paraffin-embedded rat brain. Glutathione reductase antibody [N2C2], Internal diluted at 1:500.
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
TBC1D9 Antibody
NBP2-13415
Immunocytochemistry/Immunofluorescence: TBC1D9 Antibody [NBP2-13415] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: TBC1D9 Antibody [NBP2-13415] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Glucosylceramidase/GBA
H00002629-M01
Western Blot: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - GBA monoclonal antibody (M01), clone 2E2 Analysis of GBA expression in MCF-7.
Immunocytochemistry/Immunofluorescence: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (2E2) [H00002629-M01] - Analysis of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(2 Publications)
Species: Hu
Applications: WB, IHC, ICC
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(3 Reviews)
(10 Publications)
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
SMPD1 Antibody
(OTI3H7)
NBP2-45889
Western Blot: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SMPD1.
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: SMPD1 Antibody (3H7) [NBP2-45889] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in control (vector only transfected HEK293T lysate) and QPCT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining in human adrenal gland and liver tissues using anti-QPCT antibody. Corresponding QPCT RNA-seq data are presented for the same tissues.
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
ZNF198 Antibody
NBP1-84685
Immunocytochemistry/Immunofluorescence: ZNF198 Antibody [NBP1-84685] - Staining of human cell line A-431 shows localization to nucleoplasm & endoplasmic reticulum.
Immunohistochemistry-Paraffin: ZNF198 Antibody [NBP1-84685] - Staining of human liver shows very weak positivity in hepatocytes.
Immunohistochemistry-Paraffin: ZNF198 Antibody [NBP1-84685] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NRF2 stained by NRF2 antibody [N2C2], Internal diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:100.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - Human breast carcinoma. NRF2 stained by NRF2 antibody [N2C2], Internal diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(4 Reviews)
(15 Publications)
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
Glutathione
Synthetase Antibody ( ...
NBP2-75513
Western Blot: Glutathione Synthetase Antibody (JB95-33) [NBP2-75513] - Analysis of Glutathione Synthetase on different lysates using anti-Glutathione Synthetase antibody at 1/500 dilution.Positive control:Lane 1: SiHa Lane 2: Mouse colonLane 3: Rat liver
Immunocytochemistry/Immunofluorescence: Glutathione Synthetase Antibody (JB95-33) [NBP2-75513] - Staining Glutathione Synthetase in LOVO cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Glutathione Synthetase Antibody (JB95-33) [NBP2-75513] - Analysis of paraffin-embedded rat epididymis tissue using anti-Glutathione Synthetase antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for UGCG Antibody (H00007357-M03)(3)


Review for UGCG Antibody (H00007357-M03) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007357-M03:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UGCG H00007357-M03
Enlarge
reviewed by:
Anonymous
 WB Human 04/17/2010
View

Summary

ApplicationWestern Blot
Sample TestedHT29 human colorectal carcinoma cells, Sample Amount: 40ug
SpeciesHuman
CommentsSpecific band for GCS (UGCG) at predicted size in literature. Showed specificity of antibody by using specific anti-UGCG shRNA.

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#Cell Signaling

Details

Detection NotesMethod: ECL, Exposure Time: 3 min, Specific Bands: 35kDa, Non-Specific Bands: Some weak bands ~35kDa; remove by extra washing

Comments

CommentsSpecific band for GCS (UGCG) at predicted size in literature. Showed specificity of antibody by using specific anti-UGCG shRNA.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCG Antibody (H00007357-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

UGCG Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional UGCG Products

Bioinformatics Tool for UGCG Antibody (H00007357-M03)

Discover related pathways, diseases and genes to UGCG Antibody (H00007357-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGCG Antibody (H00007357-M03)

Discover more about diseases related to UGCG Antibody (H00007357-M03).
 

Pathways for UGCG Antibody (H00007357-M03)

View related products by pathway.

PTMs for UGCG Antibody (H00007357-M03)

Learn more about PTMs related to UGCG Antibody (H00007357-M03).

Blogs on UGCG

There are no specific blogs for UGCG, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot UGCG H00007357-M03
Enlarge
 Anonymous
04/17/2010
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol UGCG
Entrez
Uniprot
Novus 100% Guarantee