UGCG Antibody (1E5.)

Images

 
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Analysis of UGCG expression in HL-60.
Western Blot: UGCG Antibody (1E5) [H00007357-M03] - Detection of UGCG in HT29 human colon carcinoma cells. Image provided courtesy of Dr. James Madigan.
ELISA: UGCG Antibody (1E5.) [H00007357-M03] - UGCG Antibody (1E5) [H00007357-M03] - Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGCG Antibody (1E5.) Summary

Immunogen
UGCG (NP_003349, 33 a.a. - 131 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Specificity
Reacts with UDP-glucose ceramide glucosyltransferase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UGCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Positive Control
UGCG Lysate (NBP2-65397)
Reviewed Applications
Read 1 Review rated 5
using
H00007357-M03 in the following applications:

Publications
Read Publications using H00007357-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGCG Antibody (1E5.)

  • ceramide glucosyltransferase
  • EC 2.4.1.80
  • GCSGLCT1
  • GLCT-1
  • Glucosylceramide synthase
  • UDP-glucose ceramide glucosyltransferaseUDP-glucose:N-acylsphingosine D-glucosyltransferase

Background

Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-89728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-24940
Species: Hu, Ye
Applications: WB
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45889
Species: Hu
Applications: WB, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-30465
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA

Publications for UGCG Antibody (H00007357-M03)(3)

Review for UGCG Antibody (H00007357-M03) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007357-M03:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UGCG H00007357-M03
Enlarge
reviewed by:
Anonymous
WB Human 04/17/2010
View

Summary

ApplicationWestern Blot
Sample TestedHT29 human colorectal carcinoma cells, Sample Amount: 40ug
SpeciesHuman
CommentsSpecific band for GCS (UGCG) at predicted size in literature. Showed specificity of antibody by using specific anti-UGCG shRNA.

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#Cell Signaling

Details

Detection NotesMethod: ECL, Exposure Time: 3 min, Specific Bands: 35kDa, Non-Specific Bands: Some weak bands ~35kDa; remove by extra washing

Comments

CommentsSpecific band for GCS (UGCG) at predicted size in literature. Showed specificity of antibody by using specific anti-UGCG shRNA.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCG Antibody (H00007357-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for UGCG Antibody (H00007357-M03)

Discover related pathways, diseases and genes to UGCG Antibody (H00007357-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGCG Antibody (H00007357-M03)

Discover more about diseases related to UGCG Antibody (H00007357-M03).
 

Pathways for UGCG Antibody (H00007357-M03)

View related products by pathway.

PTMs for UGCG Antibody (H00007357-M03)

Learn more about PTMs related to UGCG Antibody (H00007357-M03).

Blogs on UGCG

There are no specific blogs for UGCG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
04/17/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol UGCG
Entrez
Uniprot