Sphingomyelin synthase 1 Antibody

Images

 
Western Blot: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunocytochemistry/ Immunofluorescence: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody ...read more
Immunohistochemistry-Paraffin: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Staining of human oral mucosa shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sphingomyelin synthase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASTMKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM
Specificity
Specificity of human Sphingomyelin synthase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGMS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Sphingomyelin synthase 1 Protein (NBP1-92435PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sphingomyelin synthase 1 Antibody

  • MGC17342
  • MOBProtein Mob
  • phosphatidylcholine:ceramide cholinephosphotransferase 1
  • SMS1EC 2.7.8.27
  • sphingomyelin synthase 1Medulla oblongata-derived protein
  • TMEM23hmob33
  • Transmembrane protein 23MOB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60004
Species: Hu, Mu
Applications: WB
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61873
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP1-84907
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-197
Species: Hu, Mu
Applications: WB, IP
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74751
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92435
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sphingomyelin synthase 1 Antibody (NBP1-92435) (0)

There are no publications for Sphingomyelin synthase 1 Antibody (NBP1-92435).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sphingomyelin synthase 1 Antibody (NBP1-92435) (0)

There are no reviews for Sphingomyelin synthase 1 Antibody (NBP1-92435). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sphingomyelin synthase 1 Antibody (NBP1-92435) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Sphingomyelin synthase 1 Antibody (NBP1-92435)

Discover related pathways, diseases and genes to Sphingomyelin synthase 1 Antibody (NBP1-92435). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sphingomyelin synthase 1 Antibody (NBP1-92435)

Discover more about diseases related to Sphingomyelin synthase 1 Antibody (NBP1-92435).
 

Pathways for Sphingomyelin synthase 1 Antibody (NBP1-92435)

View related products by pathway.

PTMs for Sphingomyelin synthase 1 Antibody (NBP1-92435)

Learn more about PTMs related to Sphingomyelin synthase 1 Antibody (NBP1-92435).

Blogs on Sphingomyelin synthase 1

There are no specific blogs for Sphingomyelin synthase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sphingomyelin synthase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGMS1