Recombinant Human SAMD8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SAMD8 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 326 of Human SAMD8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTECKYLFSASMRIR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SAMD8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SAMD8 Protein

  • FLJ25082
  • SAM domain-containing protein 8
  • SMSr
  • sphingomyelin synthase related
  • sphingomyelin synthase-related protein 1
  • sterile alpha motif domain containing 8
  • Sterile alpha motif domain-containing protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60004
Species: Hu, Mu
Applications: WB
NBP2-04611
Species: Hu
MAB3694
Species: Hu
Applications: WB, IHC
NBP1-76791
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58284
Species: Hu
Applications: WB, ICC/IF
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
NBP2-15512
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30414
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14181
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
870-LP/CF
Species: Hu
NBP2-15009
Species: Hu, Mu
Applications: WB
NBP2-58972
Species: Hu
Applications: WB, ICC/IF
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-61625
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SAMD8 Recombinant Protein (H00142891-P01) (0)

There are no publications for SAMD8 Recombinant Protein (H00142891-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAMD8 Recombinant Protein (H00142891-P01) (0)

There are no reviews for SAMD8 Recombinant Protein (H00142891-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAMD8 Recombinant Protein (H00142891-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAMD8 Products

Bioinformatics Tool for SAMD8 Recombinant Protein (H00142891-P01)

Discover related pathways, diseases and genes to SAMD8 Recombinant Protein (H00142891-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for SAMD8 Recombinant Protein (H00142891-P01)

Find related products by research area.

Blogs on SAMD8

There are no specific blogs for SAMD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SAMD8 Antibody
NBP1-60113
ATP5A Antibody
NBP2-15512

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SAMD8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SAMD8