nSMase Antibody

Images

 
Western Blot: nSMase Antibody [NBP1-87810] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: nSMase Antibody [NBP1-87810] - Staining of human cell line U-2 OS shows localization to plasma membrane & vesicles. Antibody staining shown in green.
Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, FiSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

nSMase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST
Specificity
Specificity of human nSMase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
nSMase Protein (NBP1-87810PEP)
Publications
Read Publication using
NBP1-87810 in the following applications:

  • WB
    1 publication

Reactivity Notes

Fish reactivity reported in scientific literature (PMID: 31401171).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for nSMase Antibody

  • EC 3.1.4.12
  • ISC1
  • lyso-PAF-PLC
  • Lyso-platelet-activating factor-phospholipase C
  • Neutral sphingomyelinase
  • NSMASE
  • N-SMase
  • NSMASE1
  • sphingomyelin phosphodiesterase 2
  • sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45889
Species: Hu
Applications: WB, IHC, IHC-Fr
MAB7184
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
H00728695-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
MAB5018
Species: Hu
Applications: WB, IP
NBP1-87810
Species: Hu, Fi
Applications: WB, ICC/IF, IHC, IHC-P

Publications for nSMase Antibody (NBP1-87810)(1)

We have publications tested in 1 confirmed species: Fish.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Fish
(1)
All Species

Reviews for nSMase Antibody (NBP1-87810) (0)

There are no reviews for nSMase Antibody (NBP1-87810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for nSMase Antibody (NBP1-87810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional nSMase Products

Bioinformatics Tool for nSMase Antibody (NBP1-87810)

Discover related pathways, diseases and genes to nSMase Antibody (NBP1-87810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for nSMase Antibody (NBP1-87810)

Discover more about diseases related to nSMase Antibody (NBP1-87810).
 

Pathways for nSMase Antibody (NBP1-87810)

View related products by pathway.

Research Areas for nSMase Antibody (NBP1-87810)

Find related products by research area.

Blogs on nSMase

There are no specific blogs for nSMase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our nSMase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPD2