nSMase Antibody - BSA Free

Western Blot: nSMase Antibody [NBP1-87810] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

nSMase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMPD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  nSMase Protein (NBP1-87810PEP)

Reactivity Notes

Fish reactivity reported in scientific literature (PMID: 31401171).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for nSMase Antibody - BSA Free

• EC 3.1.4.12
• ISC1
• lyso-PAF-PLC
• Lyso-platelet-activating factor-phospholipase C
• Neutral sphingomyelinase
• NSMASE
• N-SMase
• NSMASE1
• sphingomyelin phosphodiesterase 2
• sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Background

Sphingomyelin is also present in all eukaryotic cell membranes, especially the plasma membrane, and is particularly concentrated in the nervous system because sphingomyelin is a major component of myelin, the fatty insulation wrapped around nerve cells by Schwann cells or oligodendrocytes. Multiple Sclerosis is a disease characterised by deterioration of the myelin sheath, leading to impairment of nervous conduction. nSMase (Neutral sphingomyelinase; Sphingomyelin phosphodiesterase 2) converts sphingomyelin to ceramide. Although widely expressed in all tissues examined, except the spleen, high enzymatic activity occurs only in the brain. Mice lacking Smpd2 and Smpd3 are completely devoid of neutral SMase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for nSMase Antibody (NBP1-87810)(1)

Publication using NBP1-87810

• Wang T, Zhu W, Zhang H et al. Integrated analysis of proteomics and metabolomics reveals the potential sex determination mechanism in Odontobutis potamophila J Proteomics 2019-08-08 [PMID: 31401171] (WB, Fish)

Bioinformatics

• Gene Symbol: SMPD2