nSMase Antibody

Images

 
Western Blot: nSMase Antibody [NBP1-87810] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: nSMase Antibody [NBP1-87810] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.
Immunohistochemistry-Paraffin: nSMase Antibody [NBP1-87810] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

nSMase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
nSMase Protein (NBP1-87810PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for nSMase Antibody

  • EC 3.1.4.12
  • ISC1
  • lyso-PAF-PLC
  • Lyso-platelet-activating factor-phospholipase C
  • Neutral sphingomyelinase
  • NSMASE
  • N-SMase
  • NSMASE1
  • sphingomyelin phosphodiesterase 2
  • sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45889
Species: Hu
Applications: WB, IHC
MAB7184
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
MAB5018
Species: Hu
Applications: WB, IP
NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for nSMase Antibody (NBP1-87810) (0)

There are no publications for nSMase Antibody (NBP1-87810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nSMase Antibody (NBP1-87810) (0)

There are no reviews for nSMase Antibody (NBP1-87810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for nSMase Antibody (NBP1-87810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional nSMase Products

Bioinformatics Tool for nSMase Antibody (NBP1-87810)

Discover related pathways, diseases and genes to nSMase Antibody (NBP1-87810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for nSMase Antibody (NBP1-87810)

Discover more about diseases related to nSMase Antibody (NBP1-87810).
 

Pathways for nSMase Antibody (NBP1-87810)

View related products by pathway.

Research Areas for nSMase Antibody (NBP1-87810)

Find related products by research area.

Blogs on nSMase

There are no specific blogs for nSMase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our nSMase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPD2