Spectrin beta 2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQEL |
Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SPTBN1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Spectrin beta 2 Antibody
Background
Spectrin Beta 2 is a major constituent of the erythrocyte skeleton. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface, and transmembrane movement of phospholipids and cholesterol.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Publications for Spectrin beta 2 Antibody (NBP1-86088) (0)
There are no publications for Spectrin beta 2 Antibody (NBP1-86088).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Spectrin beta 2 Antibody (NBP1-86088) (0)
There are no reviews for Spectrin beta 2 Antibody (NBP1-86088).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Spectrin beta 2 Antibody (NBP1-86088) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Spectrin beta 2 Products
Bioinformatics Tool for Spectrin beta 2 Antibody (NBP1-86088)
Discover related pathways, diseases and genes to Spectrin beta 2 Antibody (NBP1-86088). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Spectrin beta 2 Antibody (NBP1-86088)
Discover more about diseases related to Spectrin beta 2 Antibody (NBP1-86088).
| | Pathways for Spectrin beta 2 Antibody (NBP1-86088)
View related products by pathway.
|
PTMs for Spectrin beta 2 Antibody (NBP1-86088)
Learn more about PTMs related to Spectrin beta 2 Antibody (NBP1-86088).
| | Research Areas for Spectrin beta 2 Antibody (NBP1-86088)
Find related products by research area.
|
Blogs on Spectrin beta 2