Novus Biologicals products are now on bio-techne.com

Spectrin beta 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Analysis in human lung and skeletal muscle tissues using NBP1-86088 antibody. Corresponding SPTBN1 RNA-seq data are ...read more
Western Blot: Spectrin beta 2 Antibody [NBP1-86088] - Analysis in human cell line WM-115.
Immunocytochemistry/ Immunofluorescence: Spectrin beta 2 Antibody [NBP1-86088] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - staining of human cerebral cortex shows moderate to strong positivity in neuropil.
Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Staining of human lung shows weak to moderate positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Spectrin beta 2 Antibody [NBP1-86088] - Staining of human pancreas shows weak to moderate membranous positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Spectrin beta 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQEL
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTBN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Spectrin beta 2 Protein (NBP1-86088PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Spectrin beta 2 Antibody

  • beta-fodrin
  • beta-G spectrin
  • Beta-II spectrin
  • beta-spectrin 2
  • beta-spectrin II
  • betaSpII
  • ELF
  • embryonic liver beta-fodrin
  • Fodrin beta chain
  • spectrin beta chain, brain 1
  • spectrin, beta, non-erythrocytic 1
  • Spectrin, non-erythroid beta chain 1
  • SPTB2

Background

Spectrin Beta 2 is a major constituent of the erythrocyte skeleton. The membrane skeleton influences several cellular properties such as cell shape, restriction of mobility of the integral membrane protein exposed at the cell surface, and transmembrane movement of phospholipids and cholesterol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY4517-05
Species: Mu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-53093
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP1-60046
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
DY417
Species: Mu
Applications: ELISA

Publications for Spectrin beta 2 Antibody (NBP1-86088) (0)

There are no publications for Spectrin beta 2 Antibody (NBP1-86088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 2 Antibody (NBP1-86088) (0)

There are no reviews for Spectrin beta 2 Antibody (NBP1-86088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Spectrin beta 2 Antibody (NBP1-86088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Spectrin beta 2 Products

Research Areas for Spectrin beta 2 Antibody (NBP1-86088)

Find related products by research area.

Blogs on Spectrin beta 2

There are no specific blogs for Spectrin beta 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spectrin beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN1