ASAH1 Antibody

Images

 
Western Blot: ASAH1 Antibody [NBP1-89296] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASAH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASAH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ASAH1 Protein (NBP1-89296PEP)
Publications
Read Publications using
NBP1-89296 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (86%). Reactivity reported in scientific literature (PMID: 22261821)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASAH1 Antibody

  • ACDase
  • ACEC 3.5.1.23
  • Acid CDase
  • acid ceramidase
  • Acylsphingosine deacylase
  • ASAH
  • FLJ21558
  • FLJ22079
  • N-acylsphingosine amidohydrolase (acid ceramidase) 1
  • N-acylsphingosine amidohydrolase
  • PHP
  • PHP32N-acylsphingosine amidohydrolase (acid ceramidase)
  • Putative 32 kDa heart protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ASAH1 Antibody (NBP1-89296)(5)

Reviews for ASAH1 Antibody (NBP1-89296) (0)

There are no reviews for ASAH1 Antibody (NBP1-89296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASAH1 Antibody (NBP1-89296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASAH1 Products

Bioinformatics Tool for ASAH1 Antibody (NBP1-89296)

Discover related pathways, diseases and genes to ASAH1 Antibody (NBP1-89296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAH1 Antibody (NBP1-89296)

Discover more about diseases related to ASAH1 Antibody (NBP1-89296).
 

Pathways for ASAH1 Antibody (NBP1-89296)

View related products by pathway.

PTMs for ASAH1 Antibody (NBP1-89296)

Learn more about PTMs related to ASAH1 Antibody (NBP1-89296).

Blogs on ASAH1

There are no specific blogs for ASAH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAH1