ASAH1 Antibody

Western Blot: ASAH1 Antibody [NBP1-89296] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.

Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ASAH1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASAH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ASAH1 Protein (NBP1-89296PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (86%). Reactivity reported in scientific literature (PMID: 22261821).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ASAH1 Antibody

• ACDase
• ACEC 3.5.1.23
• Acid CDase
• acid ceramidase
• Acylsphingosine deacylase
• ASAH
• FLJ21558
• FLJ22079
• N-acylsphingosine amidohydrolase (acid ceramidase) 1
• N-acylsphingosine amidohydrolase
• PHP
• PHP32N-acylsphingosine amidohydrolase (acid ceramidase)
• Putative 32 kDa heart protein

Background

ASAH1 encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASAH1 Antibody (NBP1-89296)(6)

Publications using NBP1-89296

• Cho SM, Lee HK, Liu Q et al. A guanidine-based synthetic compound suppresses angiogenesis via inhibition of acid ceramidase ACS Chem. Biol. 2018-12-03 [PMID: 30507149] (WB, Human)
• Cai K, Lucki NC, Sewer MB. Silencing diacylglycerol kinase-theta expression reduces steroid hormone biosynthesis and cholesterol metabolism in human adrenocortical cells. Biochim Biophys Acta 2014-04-04 [PMID: 24369117] (WB, Human)
• Lucki NC, Li D, Bandyopadhyay S et al. Acid Ceramidase (ASAH1) Represses Steroidogenic Factor 1-Dependent Gene Transcription in H295R Human Adrenocortical Cells by Binding to the Receptor. Mol Cell Biol 2012-11-01 [PMID: 22927646]
• Lucki NC, Bandyopadhyay S, Wang E et al. Acid Ceramidase (ASAH1) Is a Global Regulator of Steroidogenic Capacity and Adrenocortical Gene Expression. Mol Endocrinol 2012-02-01 [PMID: 22261821]
• Lucki NC, Sewer MB et al. Genistein stimulates MCF-7 breast cancer cell growth by inducing acid ceramidase (ASAH1) gene expression. J Biol Chem 2011-06-01 [PMID: 21493710]
• Lucki N, Sewer MB et al. The cAMP-responsive element binding protein (CREB) regulates the expression of acid ceramidase (ASAH1) in H295R human adrenocortical cells. Biochim Biophys Acta 2009-08-01 [PMID: 19298866]

Bioinformatics

• Gene Symbol: ASAH1