Alpha Fodrin Antibody

Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and rat brain, Antibody Titration: 0.2-1 ug/ml

Immunocytochemistry/Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in methanol-aceton fixed Caco-2 cells using anti-Alpha Fodrin antibody. Image from verified customer review.

Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue.

Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2 whole cell lysate using anti-Alpha Fodrin antibody. Image from verified customer review.

Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-53093] - Human Kidney tissue, 5 ug/ml.

Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Alpha Fodrin Antibody Summary

• Immunogen: Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPTAN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against SPTAN1 and was validated on Western blot.
• Theoretical MW: 272 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Alpha Fodrin Antibody

• Alpha-II spectrin
• EIEE5
• FLJ17738
• FLJ44613
• Fodrin alpha chain
• NEAS
• spectrin alpha chain, brain
• spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
• Spectrin, non-erythroid alpha chain
• SPTA2

Background

Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPTAN1
• Uniprot:
  • Q13813(Human)