Alpha Fodrin Antibody

Images

 
Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and rat brain, Antibody Titration: 0.2-1 ug/ml
Immunocytochemistry/ Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in methanol-aceton fixed Caco-2 cells using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue.
Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2 whole cell lysate using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-53093] - Human Kidney tissue, 5 ug/ml.
Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alpha Fodrin Antibody Summary

Immunogen
Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTAN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SPTAN1 and was validated on Western blot.
Theoretical MW
272 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-53093 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Alpha Fodrin Antibody

  • Alpha-II spectrin
  • EIEE5
  • FLJ17738
  • FLJ44613
  • Fodrin alpha chain
  • NEAS
  • spectrin alpha chain, brain
  • spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
  • Spectrin, non-erythroid alpha chain
  • SPTA2

Background

Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Alpha Fodrin Antibody (NBP1-53093) (0)

There are no publications for Alpha Fodrin Antibody (NBP1-53093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Fodrin Antibody (NBP1-53093) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: IF, WB.

Reviews using NBP1-53093:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Alpha Fodrin NBP1-53093
Enlarge
reviewed by:
Anonymous
IF Human 03/25/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedCaco-2 cells
SpeciesHuman

Blocking

Blocking DetailsNo blocking

Primary Anitbody

Dilution Ratio1/200 dilution in 1xPBS, 1hour at RT

Secondary Antibody

Secondary DescriptionCy3 anti-rabbit

Details

Detection NotesImmunoflourescence microscopy
Fixation DetailsMethanol-Aceton fixation
Wash Description3x washiung with 1xPBS
Western Blot Alpha Fodrin NBP1-53093
Enlarge
reviewed by:
Anonymous
WB Human 03/23/2015
View

Summary

ApplicationWestern Blot
Sample TestedCaco-2 whole cell lysate
SpeciesHuman

Blocking

Blocking Details1 hour, at room temperature, with 5% non-fat milk powder solution (in 1xPBS)

Primary Anitbody

Dilution RatioDilution: 1/1000, Incubation time: 1 hour at room temperature

Secondary Antibody

Secondary DescriptionHRP

Details

Detection NotesEnhanced chemiluminescence (ECL) detection method, exposure time: 1-2 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alpha Fodrin Antibody (NBP1-53093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha Fodrin Products

Bioinformatics Tool for Alpha Fodrin Antibody (NBP1-53093)

Discover related pathways, diseases and genes to Alpha Fodrin Antibody (NBP1-53093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Fodrin Antibody (NBP1-53093)

Discover more about diseases related to Alpha Fodrin Antibody (NBP1-53093).
 

Pathways for Alpha Fodrin Antibody (NBP1-53093)

View related products by pathway.

Blogs on Alpha Fodrin

There are no specific blogs for Alpha Fodrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
03/25/2015
Application: IF
Species: Human

Anonymous
03/23/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol SPTAN1
Uniprot