Alpha Fodrin Antibody


Western Blot: Alpha Fodrin Antibody [NBP1-53093] - NT-2 cell line, mouse brain, and rat brain, Antibody Titration: 0.2-1 ug/ml
Immunocytochemistry/ Immunofluorescence: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in methanol-aceton fixed Caco-2 cells using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunohistochemistry: Alpha Fodrin Antibody [NBP1-53093] - Immunohistochemistry with NT-2 cell line, mouse brain, and rat brain tissue.
Western Blot: Alpha Fodrin Antibody [NBP1-53093] - analysis of Alpha Fodrin in caco-2 whole cell lysate using anti-Alpha Fodrin antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Alpha Fodrin Antibody [NBP1-53093] - Human Kidney tissue, 5 ug/ml.
Immunoprecipitation: Alpha Fodrin Antibody [NBP1-53093] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP

Order Details

Alpha Fodrin Antibody Summary

Synthetic peptides corresponding to SPTAN1(spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)) The peptide sequence was selected from the N terminal of SPTAN1. Peptide sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SPTAN1 and was validated on Western blot.
Theoretical MW
272 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Alpha Fodrin Lysate (NBP2-65727)
Reviewed Applications
Read 2 Reviews rated 4.5
NBP1-53093 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Alpha Fodrin Antibody

  • Alpha-II spectrin
  • EIEE5
  • FLJ17738
  • FLJ44613
  • Fodrin alpha chain
  • NEAS
  • spectrin alpha chain, brain
  • spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
  • Spectrin, non-erythroid alpha chain
  • SPTA2


Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Alpha Fodrin Antibody (NBP1-53093) (0)

There are no publications for Alpha Fodrin Antibody (NBP1-53093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Fodrin Antibody (NBP1-53093) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-53093:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Alpha Fodrin NBP1-53093
reviewed by:
IF Human 03/25/2015


Sample TestedCaco-2 cells


Blocking DetailsNo blocking

Primary Anitbody

Dilution Ratio1/200 dilution in 1xPBS, 1hour at RT

Secondary Antibody

Secondary DescriptionCy3 anti-rabbit


Detection NotesImmunoflourescence microscopy
Fixation DetailsMethanol-Aceton fixation
Wash Description3x washiung with 1xPBS
Western Blot Alpha Fodrin NBP1-53093
reviewed by:
WB Human 03/23/2015


ApplicationWestern Blot
Sample TestedCaco-2 whole cell lysate


Blocking Details1 hour, at room temperature, with 5% non-fat milk powder solution (in 1xPBS)

Primary Anitbody

Dilution RatioDilution: 1/1000, Incubation time: 1 hour at room temperature

Secondary Antibody

Secondary DescriptionHRP


Detection NotesEnhanced chemiluminescence (ECL) detection method, exposure time: 1-2 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alpha Fodrin Antibody (NBP1-53093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Alpha Fodrin Products

Bioinformatics Tool for Alpha Fodrin Antibody (NBP1-53093)

Discover related pathways, diseases and genes to Alpha Fodrin Antibody (NBP1-53093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Fodrin Antibody (NBP1-53093)

Discover more about diseases related to Alpha Fodrin Antibody (NBP1-53093).

Pathways for Alpha Fodrin Antibody (NBP1-53093)

View related products by pathway.

Blogs on Alpha Fodrin

There are no specific blogs for Alpha Fodrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IF
Species: Human

Application: WB
Species: Human


Gene Symbol SPTAN1