Home » NF2/Merlin » Merlin Antibodies » NF2/Merlin Antibody

NF2/Merlin Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

NF2/Merlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP, WB reported in the scientific literature (PMID: 26109051).
Control Peptide
NF2/Merlin Protein (NBP1-87757PEP)
Publications
Read Publications using
NBP1-87757 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23863479)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NF2/Merlin Antibody

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human prostate shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Frozen: DIO2 Antibody [NBP1-00178] - IHC analysis of DIO2 in cryo-sectioned Mouse Hippocampus using NBP1-00178 at 2ug/ml. Microwaved antigen retrieval with citrate buffer pH 4.5, HRP-staining.
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Dopamine D1R/DRD1
Antibody (SG2-D1a)
NB110-60017
Immunohistochemistry: Dopamine D1R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Dopamine D1 R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of Dopamine Receptor D1 in rat retinal whole mounts and sections. Image from verified customer review.
Western Blot: Dopamine D1R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of lysates from Sf9 cells which were transfected with rat DR-D1b (Lane 1) or DR-D1a (Lane 2) using DRD1 antibody (clone SG2-D1a). This clone detected D1a receptor only and was not cross-reactive against DR-D1b (Note: these results are similiar to those shown in J. Neuroimmunol. 101:170-187 publication.)
Immunohistochemistry Free-Floating: Dopamine D1R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Dopamine D1 R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of Dopamine D1 R in free floating rat brain slices using Dopamine D1 R antibody. Image from verified customer review.
(3 Reviews)
(12 Publications)
Species: Bv(-), Ca(-), Hu(-), Mu, Po(-), Rb(-), Rt, Sh(-)
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB
Ezrin Antibody -
BSA Free
NBP2-52977
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- conjugated to Alexa Fluor 647 (NBP2-52977AF647) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with Ezrin Antibody (NBP2-52977) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-EZR at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Moesin Antibody
(MSN/491) - Azide and ...
NBP2-34685
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/491) - Azide and BSA Free [NBP2-34685] - Formalin-paraffin human placenta stained with moesin MAb (MSN/491)
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/491) - Azide and BSA Free [NBP2-34685] - Formalin-paraffin human Melanoma stained with moesin MAb (MSN/491)
Western Blot: Moesin Antibody (MSN/491) - Azide and BSA Free [NBP2-34685] - Western blot of HT29 Cell Lysate using Moesin MAb (MSN/491).
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Radixin Antibody
(SC06-14)
NBP2-67584
Flow Cytometry: Radixin Antibody (SC06-14) [NBP2-67584] - Analysis of Hela cells with Radixin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Radixin Antibody (SC06-14) [NBP2-67584] - Staining Radixin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Radixin Antibody (SC06-14) [NBP2-67584] - Analysis of paraffin-embedded human kidney tissue using anti-Radixin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Dopamine D2R/DRD2
Antibody
NBP2-88996
ELISA: Dopamine D2R/DRD2 Antibody [NBP2-88996] - HEK293 cells expressing dopamine receptor (D2) were treated with indicated concentrations of agonist (Quinpirol) and antagonist (Siperone) and probed with Dopamine Receptor (D2) pAb (1:1000 of a stock solution of 1ug/uL) by cellular ELISA. Data from vehicle treated cells were taken as 100%. Results are the mean -+SEM (n=3).
Immunohistochemistry: Dopamine D2R/DRD2 Antibody [NBP2-88996] - Rat cerebral cortex. Neurons are labeled with Dopamine Receptor (D2) pAb in conjunction with Cy3 conjugated rabbit IgG antibody (H+L).
Western Blot: Dopamine D2R/DRD2 Antibody [NBP2-88996] - MW marker (1) and 10ug of rat heart membrane extract (2) probed with Dopamine Receptor (D2) pAb at 4.0ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Neprilysin/CD10 was detected in perfusion fixed frozen sections of mouse brain (glial cell in hippocampus) using 15 µg/mL Goat Anti-Mouse Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1126) overnight at 4 °C. Tissue was stained (red) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(7 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Adenosine A2aR
Antibody (7F6-G5-A2) ...
NBP1-39474
Western Blot: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - Total protein from mouse brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Adenosine A2a R (7F6-G5-A2) in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Adenosine A2a R (7F6-G5-A2), NBP1-39474, at a 1:50 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Adenosine A2a R (7F6-G5-A2), NBP1-39474, at a 1:50 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(14 Publications)
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NF2/Merlin Antibody
NBP1-87757
NF2/Merlin Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for NF2/Merlin Antibody (NBP1-87757)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NF2/Merlin Antibody (NBP1-87757) (0)

There are no reviews for NF2/Merlin Antibody (NBP1-87757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NF2/Merlin Antibody (NBP1-87757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NF2/Merlin Products

Bioinformatics Tool for NF2/Merlin Antibody (NBP1-87757)

Discover related pathways, diseases and genes to NF2/Merlin Antibody (NBP1-87757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF2/Merlin Antibody (NBP1-87757)

Discover more about diseases related to NF2/Merlin Antibody (NBP1-87757).
 

Pathways for NF2/Merlin Antibody (NBP1-87757)

View related products by pathway.

PTMs for NF2/Merlin Antibody (NBP1-87757)

Learn more about PTMs related to NF2/Merlin Antibody (NBP1-87757).
 

Research Areas for NF2/Merlin Antibody (NBP1-87757)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF2/Merlin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NF2