Home » NF2/Merlin » Merlin Antibodies » NF2/Merlin Antibody

NF2/Merlin Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in human cell line U-2 OS.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NF2/Merlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
Specificity
Specificity of human, mouse, rat NF2/Merlin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
NF2/Merlin Lysate (NBP2-65209)
Control Peptide
NF2/Merlin Protein (NBP1-87757PEP)
Publications
Read Publications using
NBP1-87757 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23863479)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NF2/Merlin Antibody

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS9 Antibody
NBP1-88927
Western Blot: BBS9 Antibody [NBP1-88927] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
LMOD1 Antibody
NBP1-89396
Western Blot: LMOD1 Antibody [NBP1-89396] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human smooth muscle.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DIO2 Antibody
NBP1-00178
Immunocytochemistry/Immunofluorescence: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton.Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
Immunohistochemistry-Paraffin: DIO2 Antibody [NBP1-00178] - Staining of paraffin embedded Human Small Intestine.
Flow Cytometry: DIO2 Antibody [NBP1-00178] - Analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5%Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody
(4 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Dopamine D1 R/DRD1
Antibody (SG2-D1a)
NB110-60017
Western Blot: Dopamine D1 R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of lysates from Sf9 cells which were transfected with rat DR-D1b (Lane 1) or DR-D1a (Lane 2) using DRD1 antibody (clone SG2-D1a). This clone detected D1a receptor only and was not cross-reactive against DR-D1b (Note: these results are similiar to those shown in J. Neuroimmunol. 101:170-187 publication.)
Immunocytochemistry/Immunofluorescence: Dopamine D1 R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of Dopamine Receptor D1 in rat retinal whole mounts and sections. Image from verified customer review.
Immunohistochemistry Free-Floating: Dopamine D1 R/DRD1 Antibody (SG2-D1a) [NB110-60017] - Analysis of Dopamine D1 R in free floating rat brain slices using Dopamine D1 R antibody. Image from verified customer review.
(3 Reviews)
(8 Publications)
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-FrFl
Ezrin Antibody
NBP2-52977
Western Blot: Ezrin Antibody [NBP2-52977] - Total protein from HeLa, Ntera2 and 3T3 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-EZR in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Ezrin Antibody [NBP2-52977] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-EZR at a 1:200 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Ezrin Antibody [NBP2-52977] - IHC analysis of a formalin fixed paraffin embedded mouse kidney tissue section using rabbit anti-Ezrin antibody at 1:50 dilution. The sections were stained using HRP-DAB based detection followed by hematoxylin counterstaining. The antibody generated a membrane-cytoplasmic signal in the epithelial cells of various tubules and glomeruli did not show much of the expression.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Moesin Antibody
(MSN/491)
NBP2-32875
Western Blot: Moesin Antibody (MSN/491) [NBP2-32875] - Analysis using the Azide and BSA Free version of NBP2-32875. Detection of Moesin in human HT29 Cells.
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/491) [NBP2-32875] - Fomalin-paraffin Rat colon stained with Moesin MAb (MSN/491)
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/491) [NBP2-32875] - Formalin-paraffin human placenta stained with Moesin MAb (MSN/491)
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Radixin Antibody
(SC06-22)
NBP2-67584
Western Blot: Radixin Antibody (SC06-22) [NBP2-67584] - Analysis of Radixin on different lysates using anti-Radixin antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: A431 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: Radixin Antibody (SC06-22) [NBP2-67584] - Staining Radixin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Radixin Antibody (SC06-22) [NBP2-67584] - Analysis of paraffin-embedded mouse placenta tissue using anti-Radixin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - Analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - Analysis of FFPE mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Neprilysin/CD10
Antibody [Unconjugate
AF1182
Western blot shows lysates of LNCaP human prostate cancer cell line and PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, Recombinant Mouse Neprilysin (Catalog # 1126-ZN) (5 and 50 ng/lane) and Recombinant Human Neprilysin (CHO-expressed) (Catalog # 1182-ZNC) (5 and 50 ng/lane) were included. Specific bands were detected for Neprilysin/CD10 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neprilysin/CD10 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Adenosine A2a R
Antibody (7F6-G5-A2)
NBP1-39474
Western Blot: Adenosine A2a R Antibody (7F6-G5-A2) [NBP1-39474] - Total protein from mouse brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Adenosine A2a R (7F6-G5-A2) in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Adenosine A2a R Antibody (7F6-G5-A2) [NBP1-39474] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Adenosine A2a R (7F6-G5-A2), NBP1-39474, at a 1:50 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: Adenosine A2a R Antibody (7F6-G5-A2) [NBP1-39474] - Using the PE direct conjugate An intracellular stain was performed on SH-SY5Y cells with Adenosine A2a R (7F6-G5-A2) antibody NBP1-39474PE (blue) and a matched isotype control NB600-986PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin (PE).
(10 Publications)
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(19 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
c-Fos Antibody
NB110-75039
Western Blot: c-Fos Antibody [NB110-75039] - Analysis on marmoset brain lysate prepared in Ripa buffer containing 1% Triton-X100; 1% SDS and 1% SDC. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution 1:2000incubated at 4C overnight.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NB110-75039] - Rat trigeminal using Rabbit antibody to cFos: whole serum at a 1:500 dilution.
Immunohistochemistry-Paraffin: c-Fos Antibody [NB110-75039] - IHC on rat brain (paraffin section) using Rabbit antibody to cFos (c-fos): whole serum at 1: 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, CyTOF-ready
EGFR Antibody
[Unconjugated]
AF231
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
A431 human epithelial carcinoma cell line was stained with Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107). View our protocol for Staining Membrane-associated Proteins.
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Review)
(8 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

Publications for NF2/Merlin Antibody (NBP1-87757)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NF2/Merlin Antibody (NBP1-87757) (0)

There are no reviews for NF2/Merlin Antibody (NBP1-87757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NF2/Merlin Antibody (NBP1-87757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

NF2/Merlin Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NF2/Merlin Antibody (NBP1-87757)

Discover related pathways, diseases and genes to NF2/Merlin Antibody (NBP1-87757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF2/Merlin Antibody (NBP1-87757)

Discover more about diseases related to NF2/Merlin Antibody (NBP1-87757).
 

Pathways for NF2/Merlin Antibody (NBP1-87757)

View related products by pathway.

PTMs for NF2/Merlin Antibody (NBP1-87757)

Learn more about PTMs related to NF2/Merlin Antibody (NBP1-87757).
 

Research Areas for NF2/Merlin Antibody (NBP1-87757)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF2/Merlin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NF2