NF2/Merlin Antibody

Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Western Blot: NF2/Merlin Antibody [NBP1-87757] - Whole cell lysates from SUM159, MDA-MB-231 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. NF2/Merlin Antibody (NBP1-87757) was used for primary antibody: 1:1000, 4C, overnight. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.

Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NF2/Merlin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP, WB reported in the scientific literature (PMID: 26109051).
• Control Peptide:

  NF2/Merlin Protein (NBP1-87757PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23863479)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NF2/Merlin Antibody

• ACN
• BANF
• Merlin
• moesin-ezrin-radixin like
• Moesin-ezrin-radixin-like protein
• moesin-ezrin-radizin-like protein
• neurofibromin 2 (bilateral acoustic neuroma)
• neurofibromin 2 (merlin)
• neurofibromin-2
• NF2
• SCH
• Schwannomerlin
• Schwannomin

Background

Merlin, also known as Neurofibromin 2 (NF2), is a tumor suppressor gene. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise function of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. Merlin has been implicated in cell proliferation and cellular motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NF2/Merlin Antibody (NBP1-87757)(3)

Publications using NBP1-87757

• Chen Q, Zhang N, Xie R et al. Homeostatic control of Hippo signaling activity revealed by an endogenous activating mutation in YAP. Genes Dev. 2015-06-15 [PMID: 26109051] (WB, IP, Mouse)
• Lavado A, He Y, Pare J et al. Tumor suppressor Nf2 limits expansion of the neural progenitor pool by inhibiting Yap/Taz transcriptional coactivators. Development 2013-08-01 [PMID: 23863479]
• Zhang N, Bai H, David KK et al. The Merlin/NF2 tumor suppressor functions through the YAP oncoprotein to regulate tissue homeostasis in mammals. Dev Cell 2010-07-01 [PMID: 20643348]

Review for NF2/Merlin Antibody (NBP1-87757) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Yongkang Yang WB Human 11/24/2022

Summary

• Application: Western Blot
• Sample Tested: MCF-7,MDA-MB-231,SUM-159PT
• Species: Human
• Lot: C118972

Bioinformatics

• Gene Symbol: NF2