NF2/Merlin Antibody

Images

 
Genetic Strategies: Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.
Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

NF2/Merlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA
Specificity
Specificity of human NF2/Merlin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP, WB reported in the scientific literature (PMID: 26109051).
Control
NF2/Merlin Knockout HeLa Cell Lysate
Control Peptide
NF2/Merlin Protein (NBP1-87757PEP)
Publications
Read Publications using
NBP1-87757 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23863479)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NF2/Merlin Antibody

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-FrFl
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NLS1403
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for NF2/Merlin Antibody (NBP1-87757)(3)

Reviews for NF2/Merlin Antibody (NBP1-87757) (0)

There are no reviews for NF2/Merlin Antibody (NBP1-87757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NF2/Merlin Antibody (NBP1-87757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NF2/Merlin Products

Bioinformatics Tool for NF2/Merlin Antibody (NBP1-87757)

Discover related pathways, diseases and genes to NF2/Merlin Antibody (NBP1-87757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF2/Merlin Antibody (NBP1-87757)

Discover more about diseases related to NF2/Merlin Antibody (NBP1-87757).
 

Pathways for NF2/Merlin Antibody (NBP1-87757)

View related products by pathway.

PTMs for NF2/Merlin Antibody (NBP1-87757)

Learn more about PTMs related to NF2/Merlin Antibody (NBP1-87757).
 

Research Areas for NF2/Merlin Antibody (NBP1-87757)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF2/Merlin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NF2