SP-D Antibody - BSA Free

Western Blot: Surfactant protein D Antibody [NBP1-58977] - Human Thymus lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SP-D Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SFTPD(surfactant, pulmonary-associated protein D) The peptide sequence was selected from the middle region of SFTPD (NP_003010). Peptide sequence PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SP-D Antibody - BSA Free

• COLEC7collectin-7
• Collectin 7
• Collectin-7
• Lung surfactant protein D
• PSPD
• PSP-D
• SFTP4
• SFTP4pulmonary surfactant-associated protein D
• SFTPD
• SPD
• SP-D
• SP-Dpulmonary surfactant apoprotein
• surfactant protein D
• surfactant, pulmonary-associated protein D
• surfactant-associated protein, pulmonary 4

Background

SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant. SFTPD binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SP-D Antibody (NBP1-58977). (Showing 1 - 2 of 2 FAQ).

1. Here a customer intends to buy our Surfactant protein D Antibody, NBP1-58977. He wonders whether it is suitable for rabbit lung tissue or cells. Can you so kind to help him and me?
   • D antibody with catalogue number NBP1-58977 has been validated for Western blotting with samples from rabbit, although other applications have not yet been tested. According to the testing data of the Human Protein Atlas, who are a group that have generated protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines, surfactant protein D is highly expressed in the human lung. Unfortunately I do not have similar data available for rabbit, and your customer may wish to consult the literature for further information.
2. Could you please provide a detailed protocol on how to reconstitute it?
   • To reconstitute this antibody, you should centrifuge the vial at 12,000 x g for 20 seconds, then add 50ul of distilled water. You should then vortex the vial, and centrifuge it again to pellet the solution. The final concentration of the antibody is 1mg/ml in PBS with 2% sucrose.

Bioinformatics

• Gene Symbol: SFTPD
• Entrez:
  • 6441(Human)
• Uniprot:
  • P35247()