Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein

Images

 
Recombinant Human SP-B/Surfactant Protein B Protein [H00006439-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-381 of Human SFTPB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
SFTPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
68.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006439-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein

  • 18 kDa pulmonary-surfactant protein
  • 6 kDa protein
  • PSP-B
  • pulmonary surfactant-associated protein B
  • Pulmonary surfactant-associated proteolipid SPL(Phe)
  • SFTB3
  • SFTP3
  • SFTPB
  • SMDP1
  • SP-B surfactant, pulmonary-associated protein B
  • SP-B
  • surfactant protein B

Background

The SFTPB gene encodes the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins (Clark et al., 1995 [PubMed 7644495]). See also SFTPA1 (MIM 178630), SFTPC (MIM 178620), and SFTPD (MIM 178635).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IF
MAB4077
Species: Hu
Applications: WB, IHC
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45354
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00006439-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01)(1)

Reviews for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01) (0)

There are no reviews for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SP-B/Surfactant Protein B Products

Bioinformatics Tool for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01)

Discover related pathways, diseases and genes to SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01)

Discover more about diseases related to SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01).
 

Pathways for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01)

View related products by pathway.

PTMs for SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01)

Learn more about PTMs related to SP-B/Surfactant Protein B Recombinant Protein (H00006439-P01).

Blogs on SP-B/Surfactant Protein B

There are no specific blogs for SP-B/Surfactant Protein B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SP-B/Surfactant Protein B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPB