Prosurfactant Protein C Antibody

Images

 
Western Blot: Prosurfactant Protein C Antibody [NBP1-87201] - Analysis in human lung tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-87201] - Analysis in human lung and kidney tissues using HPA010928 antibody. Corresponding SFTPC RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-87201] - Staining of human kidney shows no positivity in cells in glomeruli as expected.
Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-87201] - Staining of human lung shows moderate to strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Prosurfactant Protein C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Specificity
Specificity of human Prosurfactant Protein C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFTPC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prosurfactant Protein C Antibody

  • PSP-C
  • pulmonary surfactant-associated protein C
  • Pulmonary surfactant-associated proteolipid SPL(Val)
  • SFTP2
  • SFTP2pulmonary surfactant apoprotein-2 SP-C
  • SMDP2surfactant, pulmonary-associated protein C
  • SP-CSP5
  • surfactant protein C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-77431
Species: Hu
Applications: WB, IHC
NBP2-35058
Species: Hu
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP2-67247
Species: Hu
Applications: WB, ICC/IF
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-80732
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
7270-IL/CF
Species: Hu
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Prosurfactant Protein C Antibody (NBP1-87201) (0)

There are no publications for Prosurfactant Protein C Antibody (NBP1-87201).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prosurfactant Protein C Antibody (NBP1-87201) (0)

There are no reviews for Prosurfactant Protein C Antibody (NBP1-87201). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prosurfactant Protein C Antibody (NBP1-87201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Prosurfactant Protein C Products

Bioinformatics Tool for Prosurfactant Protein C Antibody (NBP1-87201)

Discover related pathways, diseases and genes to Prosurfactant Protein C Antibody (NBP1-87201). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prosurfactant Protein C Antibody (NBP1-87201)

Discover more about diseases related to Prosurfactant Protein C Antibody (NBP1-87201).
 

Pathways for Prosurfactant Protein C Antibody (NBP1-87201)

View related products by pathway.

PTMs for Prosurfactant Protein C Antibody (NBP1-87201)

Learn more about PTMs related to Prosurfactant Protein C Antibody (NBP1-87201).

Blogs on Prosurfactant Protein C

There are no specific blogs for Prosurfactant Protein C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prosurfactant Protein C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPC
COVID-19 update