SOX10 Antibody

Images

 
Western Blot: SOX10 Antibody [NBP1-68983] - Analysis of HepG2 lysate Cell lysates, Antibody Dilution: 0.5 ug/ml.
Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Kidney tissue, Epithelial cells of renal tubule (Indicated with Arrows) 4-8 ug/ml.
Western Blot: SOX10 Antibody [NBP1-68983] - HepG2, 0.25ug/ml.
Western Blot: SOX10 Antibody [NBP1-68983] - SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.
Western Blot: SOX10 Antibody [NBP1-68983] - Sample Tissue: Jurkat cell lysates Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration:2.5ug/ml Peptide Concentration: ...read more
Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Kidney Tissue. Arrow indicates epithelial cells of renal tubule with positive label.
Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Skin Tissue with epidermal cells positively labeled.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX10 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SOX10 (NP_008872). Peptide sequence PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4.0-8.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SOX10 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-68983 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOX10 Antibody

  • DOM
  • MGC15649
  • PCWH
  • SOX10
  • SRY (sex determining region Y)-box 10
  • SRY-related HMG-box gene 10
  • transcription factor SOX-10
  • WS4
  • WS4C
  • WS4mouse, human homolog of

Background

SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB5579
Species: Hu
Applications: ICC
AF3075
Species: Hu
Applications: WB, ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
AF482
Species: Mu
Applications: WB, IHC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00030812-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-58020
Species: Hu
Applications: ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-68983
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SOX10 Antibody (NBP1-68983)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-68983 Applications Species
Ivanov SV, Panaccione A, Nonaka D et al. Diagnostic SOX10 gene signatures in salivary adenoid cystic and breast basal-like carcinomas. Br J Cancer 2013 Jun 25 [PMID: 23799842] (WB, Human) WB Human
Vogl MR, Reiprich S, Kuspert M et al. Sox10 Cooperates with the Mediator Subunit 12 during Terminal Differentiation of Myelinating Glia J Neurosci 2013 Apr 10 [PMID: 23575864] (WB, Human) WB Human
Panaccione AC. Identification and Characterization of Neural-like Cancer Stem Cells in Salivary Adenoid Cystic Carcinoma. Thesis. May 1 2016 (WB, Human) WB Human

Reviews for SOX10 Antibody (NBP1-68983) (0)

There are no reviews for SOX10 Antibody (NBP1-68983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX10 Antibody (NBP1-68983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX10 Products

Bioinformatics Tool for SOX10 Antibody (NBP1-68983)

Discover related pathways, diseases and genes to SOX10 Antibody (NBP1-68983). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX10 Antibody (NBP1-68983)

Discover more about diseases related to SOX10 Antibody (NBP1-68983).
 

Pathways for SOX10 Antibody (NBP1-68983)

View related products by pathway.

PTMs for SOX10 Antibody (NBP1-68983)

Learn more about PTMs related to SOX10 Antibody (NBP1-68983).

Blogs on SOX10

There are no specific blogs for SOX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX10
Entrez
Uniprot