Endothelin-3 Antibody (2A6-2A4)

Images

 
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - EDN3 monoclonal antibody (M01), clone 2A6-2A4 Analysis of EDN3 expression in LNCaP.
Western Blot: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4.Lane 1: EDN3 transfected lysate(25.5 KDa).Lane ...read more
Immunoprecipitation: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Analysis of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit ...read more
Sandwich ELISA: Endothelin-3 Antibody (2A6-2A4) [H00001908-M01] - Detection limit for recombinant GST tagged EDN3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2A6-2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Endothelin-3 Antibody (2A6-2A4) Summary

Immunogen
EDN3 (AAH08876, 1 a.a. - 238 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Specificity
EDN3 - endothelin 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EDN3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Endothelin-3 Antibody (2A6-2A4)

  • EDN3
  • endothelin 3
  • Endothelin3
  • Endothelin-3
  • ET3
  • ET-3
  • HSCR4
  • MGC15067
  • MGC61498
  • PPET3
  • preproendothelin-3
  • truncated endothelin 3
  • WS4B

Background

The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2864
Species: Hu
Applications: WB, ICC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001908-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for Endothelin-3 Antibody (H00001908-M01) (0)

There are no publications for Endothelin-3 Antibody (H00001908-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endothelin-3 Antibody (H00001908-M01) (0)

There are no reviews for Endothelin-3 Antibody (H00001908-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Endothelin-3 Antibody (H00001908-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endothelin-3 Products

Bioinformatics Tool for Endothelin-3 Antibody (H00001908-M01)

Discover related pathways, diseases and genes to Endothelin-3 Antibody (H00001908-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endothelin-3 Antibody (H00001908-M01)

Discover more about diseases related to Endothelin-3 Antibody (H00001908-M01).
 

Pathways for Endothelin-3 Antibody (H00001908-M01)

View related products by pathway.

PTMs for Endothelin-3 Antibody (H00001908-M01)

Learn more about PTMs related to Endothelin-3 Antibody (H00001908-M01).

Blogs on Endothelin-3

There are no specific blogs for Endothelin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endothelin-3 Antibody (2A6-2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol EDN3
Entrez
OMIM
Uniprot