GGTLC1 Antibody

Images

 
Western Blot: GGTLC1 Antibody [NBP1-56928] - Antibody Titration: 5.0ug/ml Positive Control: Human kidney
Immunohistochemistry-Paraffin: GGTLC1 Antibody [NBP1-56928] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GGTLC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GGTLA4(gamma-glutamyltransferase-like activity 4) The peptide sequence was selected from the C terminal of GGTLA4. Peptide sequence DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGTLC1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against GGTLA4 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GGTLC1 Antibody

  • dJ831C21.1
  • dJ831C21.2
  • EC 2.3.2.2
  • gamma-glutamyl transpeptidase
  • gamma-glutamyltransferase light chain 1
  • gamma-glutamyltransferase-like activity 3
  • Gamma-glutamyltransferase-like activity 4GGTLA3
  • Gamma-glutamyltransferase-like protein 6
  • GGTL6
  • GGTLA4MGC50550

Background

Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein encoded by this gene is similar in sequence to several members of the gamma-glutamyl transpeptidase family. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80533
Species: Mu
Applications: WB
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56928
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GGTLC1 Antibody (NBP1-56928) (0)

There are no publications for GGTLC1 Antibody (NBP1-56928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGTLC1 Antibody (NBP1-56928) (0)

There are no reviews for GGTLC1 Antibody (NBP1-56928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGTLC1 Antibody (NBP1-56928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GGTLC1 Antibody (NBP1-56928)

Discover related pathways, diseases and genes to GGTLC1 Antibody (NBP1-56928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGTLC1 Antibody (NBP1-56928)

Discover more about diseases related to GGTLC1 Antibody (NBP1-56928).

Blogs on GGTLC1

There are no specific blogs for GGTLC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGTLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGTLC1
Uniprot