SOCS-4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SOCS-4 Antibody [NBP2-58238] - Staining of human cell line A549 shows localization to nucleus & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOCS-4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SOCS-4 Antibody - BSA Free (NBP2-58238) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOCS4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SOCS-4 Recombinant Protein Antigen (NBP2-58238PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SOCS-4 Antibody - BSA Free

• CIS4
• DKFZp686J1568
• SOCS4
• SOCS-4
• SOCS7
• SOCS-7
• SSI4
• STAT4
• suppressor of cytokine signaling 4
• Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein

Background

The protein encoded by the SOCS4 gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to thesuppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS familymembers are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively splicedtranscript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOCS4