SOCS-4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SOCS-4 Antibody [NBP2-58238] - Staining of human cell line A549 shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOCS-4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS
Specificity
Specificity of human SOCS-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOCS4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SOCS-4 Recombinant Protein Antigen (NBP2-58238PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SOCS-4 Antibody

  • CIS4
  • DKFZp686J1568
  • SOCS4
  • SOCS-4
  • SOCS7
  • SOCS-7
  • SSI4
  • STAT4
  • suppressor of cytokine signaling 4
  • Suppressor of cytokine signaling 7SH2 domain containing SOCS box protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
AF4979
Species: Hu
Applications: WB
NB100-56639
Species: Hu, Mu
Applications: WB
H00009306-P01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
7270-IL/CF
Species: Hu
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
6507-IL/CF
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NBP2-45435
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-16372
Species: Hu, Mu
Applications: WB, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58238
Species: Hu
Applications: ICC/IF

Publications for SOCS-4 Antibody (NBP2-58238) (0)

There are no publications for SOCS-4 Antibody (NBP2-58238).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOCS-4 Antibody (NBP2-58238) (0)

There are no reviews for SOCS-4 Antibody (NBP2-58238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOCS-4 Antibody (NBP2-58238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SOCS-4 Antibody (NBP2-58238)

Discover related pathways, diseases and genes to SOCS-4 Antibody (NBP2-58238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOCS-4 Antibody (NBP2-58238)

Discover more about diseases related to SOCS-4 Antibody (NBP2-58238).
 

Pathways for SOCS-4 Antibody (NBP2-58238)

View related products by pathway.

PTMs for SOCS-4 Antibody (NBP2-58238)

Learn more about PTMs related to SOCS-4 Antibody (NBP2-58238).
 

Research Areas for SOCS-4 Antibody (NBP2-58238)

Find related products by research area.

Blogs on SOCS-4

There are no specific blogs for SOCS-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOCS-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOCS4