ERRFI1 Antibody (2B9)

Images

 
Western Blot: ERRFI1 Antibody (2B9) [H00054206-M01] - ERRFI1 monoclonal antibody (M01), clone 2B9 Analysis of ERRFI1 expression in HepG2.
ELISA: ERRFI1 Antibody (2B9) [H00054206-M01] - Detection limit for recombinant GST tagged ERRFI1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ERRFI1 Antibody (2B9) Summary

Immunogen
ERRFI1 (NP_061821, 111 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAA
Specificity
ERRFI1 (2B9)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ERRFI1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ERRFI1 Antibody (2B9)

  • ERBB receptor feedback inhibitor 1
  • GENE-33
  • MIG6
  • MIG-6Mitogen-inducible gene 6 protein
  • RALTreceptor-associated late transducer

Background

ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling (Makkinje et al., 2000 [PubMed 10749885]; Fiorentino et al., 2000 [PubMed 11003669]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-32311
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
MAB3481
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
NBP1-33120
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83420
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB5628
Species: Hu, Mu
Applications: WB
AF3688
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-94197
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-56639
Species: Hu, Mu, Rt
Applications: WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
H00054206-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for ERRFI1 Antibody (H00054206-M01) (0)

There are no publications for ERRFI1 Antibody (H00054206-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERRFI1 Antibody (H00054206-M01) (0)

There are no reviews for ERRFI1 Antibody (H00054206-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERRFI1 Antibody (H00054206-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERRFI1 Products

Bioinformatics Tool for ERRFI1 Antibody (H00054206-M01)

Discover related pathways, diseases and genes to ERRFI1 Antibody (H00054206-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERRFI1 Antibody (H00054206-M01)

Discover more about diseases related to ERRFI1 Antibody (H00054206-M01).
 

Pathways for ERRFI1 Antibody (H00054206-M01)

View related products by pathway.

PTMs for ERRFI1 Antibody (H00054206-M01)

Learn more about PTMs related to ERRFI1 Antibody (H00054206-M01).
 

Research Areas for ERRFI1 Antibody (H00054206-M01)

Find related products by research area.

Blogs on ERRFI1

There are no specific blogs for ERRFI1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERRFI1 Antibody (2B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol ERRFI1
Entrez
OMIM
Uniprot