SMYD3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SMYD3 Antibody [NBP3-35194] - Immunofluorescence analysis of L929 cells using SMYD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SMYD3 Antibody [NBP3-35194] - Immunofluorescence analysis of C6 cells using SMYD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: SMYD3 Antibody [NBP3-35194] - Immunofluorescence analysis of HeLa cells using SMYD3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: SMYD3 Antibody [NBP3-35194] - Immunohistochemistry analysis of paraffin-embedded Human colon using SMYD3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: SMYD3 Antibody [NBP3-35194] - Western blot analysis of various lysates using SMYD3 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMYD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMYD3 Antibody - BSA Free (NBP3-35194) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SMYD3 (NP_001161212.1).
  
  Sequence:
  DRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMYD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SMYD3 Antibody - BSA Free

• bA74P14.1 (novel protein)
• bA74P14.1
• EC 2.1.1
• EC 2.1.1.43
• FLJ21080
• KMT3E
• MGC104324
• MYND domain containing 1
• SET and MYND domain containing 3
• SET and MYND domain-containing protein 3
• SMYD3
• Zinc finger MYND domain-containing protein 1
• zinc finger protein, subfamily 3A (MYND domain containing), 1
• ZMYND1
• ZNFN3A1

Background

SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMYD3