Home » IQGAP1 » IQGAP1 Antibodies » IQGAP1 Antibody (2C5)

IQGAP1 Antibody (2C5)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined by RT-PCR and Western blot analysis, respectively. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY licence.
Genetic Strategies: Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined ...read more
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. Image collected and cropped by CiteAb from the following publication ...read more
Immunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

IQGAP1 Antibody (2C5) Summary

Immunogen
IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Specificity
IQGAP1 - IQ motif containing GTPase activating protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IQGAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Knockdown Validated
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 19706805).
Publications
Read Publications using
H00008826-M01 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IQGAP1 Antibody (2C5)

  • HUMORFA01
  • IQ motif containing GTPase activating protein 1
  • IQGAP1
  • KIAA0051ras GTPase-activating-like protein IQGAP1
  • p195
  • p195RasGAP-like with IQ motifs
  • SAR1

Background

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(14 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Angiogenin [HRP]
DAN00
Angiogenin [HRP]
(20 Publications)
Species: Hu
CDC42 Antibody
(JJ086-04)
NBP2-67895
Western Blot: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of CDC42 on different lysates using anti-CDC42 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: HepG2
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded mouse pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex). ICC/IF image submitted by a verified customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1:1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AGTR-1 Antibody
NBP1-77078
Western Blot: AGTR-1 Antibody [NBP1-77078] - Effects of Ang(1-7) and/or A-779 treatments to the sham and OVX animals for 6 weeks on the expressions of RAS different proteins and osteoclastogenesis modulating factors in the femoral bone heads. Western blot analysis bands showing the expressions of AngII, Ang(1-7), AT1R, AT2R, ACE, ACE-2, MasR, RANKL and OPG. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-02570-x) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: AGTR-1 Antibody [NBP1-77078] - Mouse Kidney cells at 20 ug/ml.
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue at 2.5 ug/mL.
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Renin Antibody
(OTI2F10)
NBP2-45552
Western Blot: Renin Antibody (2F10) [NBP2-45552] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Renin.
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: Renin Antibody (2F10) [NBP2-45552] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
(1 Publication)
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
Acetyl-coenzyme A
transporter 1 Antibod ...
NBP1-59882
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SLC33A1 is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic,Membrane Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody [NBP1-59882] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
ATM Antibody (2C1)
NB100-309
Western Blot: ATM Antibody (2C1) [NB100-309] - HeLa whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:1000. Theoretical molecular weight 351 kDa.
Immunohistochemistry-Paraffin: ATM Antibody (2C1) [NB100-309] - Human Testis (formalin-fixed, paraffin-embedded) stained with ATM antibody (2C1) [NB100-309] at 5 ug/ml followed by biotinylated anti-mouse IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Western Blot: ATM Antibody (2C1) [NB100-309] - Detection of human ATM protein using ATM antibody (2C1) [NB100-309] by western blot or immunoprecipitation. Theoretical molecular weight 351 kDa.
(3 Reviews)
(120 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Single-Cell Western
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AGTR-2 Antibody
NBP1-77368
Western Blot: AGTR-2 Antibody [NBP1-77368] - Mouse liver tissue lysate with Angiotensin II Type 2 Receptor antibody at 0.5 ug/ml.
Immunocytochemistry/Immunofluorescence: AGTR-2 Antibody [NBP1-77368] - Immunofluorescence of AGTR-2 in Jurkat cells with AGTR-2 Antibody.
Immunohistochemistry: AGTR-2 Antibody [NBP1-77368] - Representative immunofluorescent immunohistochemical stained images demonstrating the expression of ATIIR2 [red] on GFAP+ CSCs [green]. Negative control was a GBM tissue section with omission of the primary antibody. Cell nuclei were counterstained with 4', 6'-diamidino-2-phenylindole [blue]. Scale bars: 20 um. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fsurg.2016.00051/abstract), licensed under a CC-BY licence.
(20 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
E-Cadherin
Antibody [Unconjugate
AF748
E-Cadherin Antibody [Unconjugated]
(7 Reviews)
(37 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AKT1 [p Ser473]
Antibody (104A282)
NB100-56749
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - Total protein from mouse 3T3 cells treated with and without PDGF (50 ng/mL) for the indicated times was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-AKT1 (NBP2-01725) and 2 ug/mL pS473 AKT1 in 1% BSA in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the detection of phosphorylated AKT1 in response to PDGF treatment compared to total AKT1 protein.
Western Blot: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - WB of phospho AKT using phospho AKT antibody at 2 ug/mL against untreated (lane 1) and PDGF treated (lane 2) NIH-3T3 lysate. HRP conjugated secondary antibody and ECL substrate solution were used for this test. Image using the Azide and BSA Free form of this antibody.
Immunohistochemistry-Paraffin: AKT1 [p Ser473] Antibody (104A282) [NB100-56749] - IHC analysis of an FFPE human breast carcinoma tissue section using 1:250 dilution of phospho Ser473 AKT1 antibody (clone 104A282) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10 mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of phosphor-AKT (Ser-473) in the cancer cells as well as the stromal cells. Staining was performed by Histowiz.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
IQGAP1 Antibody
(2C5)
H00008826-M01
IQGAP1 Antibody (2C5)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD

Publications for IQGAP1 Antibody (H00008826-M01)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IQGAP1 Antibody (H00008826-M01) (0)

There are no reviews for IQGAP1 Antibody (H00008826-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IQGAP1 Antibody (H00008826-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional IQGAP1 Products

Bioinformatics Tool for IQGAP1 Antibody (H00008826-M01)

Discover related pathways, diseases and genes to IQGAP1 Antibody (H00008826-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IQGAP1 Antibody (H00008826-M01)

Discover more about diseases related to IQGAP1 Antibody (H00008826-M01).
 

Pathways for IQGAP1 Antibody (H00008826-M01)

View related products by pathway.

PTMs for IQGAP1 Antibody (H00008826-M01)

Learn more about PTMs related to IQGAP1 Antibody (H00008826-M01).
 

Research Areas for IQGAP1 Antibody (H00008826-M01)

Find related products by research area.

Blogs on IQGAP1

There are no specific blogs for IQGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQGAP1 Antibody (2C5) and receive a gift card or discount.


Bioinformatics

Gene Symbol IQGAP1
Entrez
OMIM
Uniprot