Home » IQGAP1 » IQGAP1 Antibodies » IQGAP1 Antibody (2C5)

IQGAP1 Antibody (2C5)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined by RT-PCR and Western blot analysis, respectively. Image collected and cropped by CiteAb from the following publication (jeccr.biomedcentral.com/articles/10.1186/1756-9966-27-77), licensed under a CC-BY licence.
Genetic Strategies: Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 mRNA and protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative and un-transfected HO-8910PM cells were determined ...read more
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. Image collected and cropped by CiteAb from the following publication ...read more
Immunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

IQGAP1 Antibody (2C5) Summary

Immunogen
IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Specificity
IQGAP1 - IQ motif containing GTPase activating protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IQGAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 19706805).
Publications
Read Publications using
H00008826-M01 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IQGAP1 Antibody (2C5)

  • HUMORFA01
  • IQ motif containing GTPase activating protein 1
  • IQGAP1
  • KIAA0051ras GTPase-activating-like protein IQGAP1
  • p195
  • p195RasGAP-like with IQ motifs
  • SAR1

Background

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody - BSA Free [NBP1-30027] - Analysis of a FFPE tissue section of human placenta using 1:200 dilution of Serpin A8 (NBP1-30027) antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Angiogenin [HRP]
DAN00
(21 Publications)
Species: Hu
Applications: ELISA
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AGTR-1 Antibody -
BSA Free
NBP1-77078
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Staining of mouse kidney tissue with antibody at 2.5 ug/ml.
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue at 2.5 ug/mL.
Western Blot: AGTR-1 Antibody [NBP1-77078] - Effects of Ang(1-7) and/or A-779 treatments to the sham and OVX animals for 6 weeks on the expressions of RAS different proteins and osteoclastogenesis modulating factors in the femoral bone heads. Western blot analysis bands showing the expressions of AngII, Ang(1-7), AT1R, AT2R, ACE, ACE-2, MasR, RANKL and OPG. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-02570-x) licensed under a CC-BY licence.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: IHC, IP, Neut, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Calmodulin antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.A2058 melanoma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. C6 glioma cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Calmodulin staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. HeLa Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Calmodulin at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(2 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Upregulation of miRNA inhibits the expression level of target genes in HK-2 cells and CKD patients. Western Blot shows that hsa-miR-4709-3p inhibit the protein level of ITGB8 and CALM3 respectively. NC: scrambled negative control transfection;4709: hsa-miR-4709-3p transfection. Image collected and cropped by CiteAb from the following publication (https://bmcnephrol.biomedcentral.com/articles/10.1186/s12882-019-1512-x) licensed under a CC-BY licence.
Western Blot: Calmodulin 3 Antibody [NBP2-15669] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 15% SDS PAGE gel, diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, WB
Acetyl-coenzyme A
transporter 1 Antibod ...
H00009197-M07
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi or non-transfected control. Blot probed with H00009197-M07. GAPDH (36.1 kDa) used as loading control.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected lysatE (60.9 KDa). Lane 2: Non-transfected lysate.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in PC-12 (Cat # L012V1).
(2 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
ATM Antibody
NB100-104
Flow Cytometry: ATM Antibody [NB100-104] - Analysis of PE conjugate of ATM Antibody [NB100-104PE]. An intracellular stain was performed on HeLa cells with ATM antibody [NB100-104PE] (blue) and a matched isotype control [NBP2-24893PE] (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Flow Cytometry: ATM Antibody [NB100-104] - An intracellular stain was performed on HepG2 cells with PE-conjugated ATM antibody [NB100-104PE] (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(96 Publications)
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(15 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AGTR-2 Antibody -
BSA Free
NBP1-77368
Immunocytochemistry/Immunofluorescence: AGTR-2 Antibody [NBP1-77368] - Jurkat cell with AGTR2 Antibody at 5 ug/ml.
Immunocytochemistry/Immunofluorescence: AGTR-2 Antibody [NBP1-77368] - Immunofluorescence of AGTR-2 in Jurkat cells with AGTR-2 Antibody.
Immunohistochemistry-Paraffin: AGTR-2 Antibody [NBP1-77368] - Representative 3,3-diaminobenzidine immunohistochemical stained images demonstrating cytoplasmic expression of SOX2, PRR, by cells within GBM, and the endothelium of the microvessels. Cytoplasmic and nuclear staining of ATIIR2 [brown] was observed on the cells within the tumor and the endothelium of the microvessels. Cell nuclei were counterstained with hematoxylin [blue]. Original magnification: 400x. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fsurg.2016.00051/abstract), licensed under a CC-BY licence.
(24 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(10 Reviews)
(43 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
IQGAP1 Antibody
(2C5)
H00008826-M01
IQGAP1 Antibody (2C5)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD

Publications for IQGAP1 Antibody (H00008826-M01)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IQGAP1 Antibody (H00008826-M01) (0)

There are no reviews for IQGAP1 Antibody (H00008826-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/Â¥70 Yuan/Â¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/Â¥150 Yuan/Â¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IQGAP1 Antibody (H00008826-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IQGAP1 Products

Bioinformatics Tool for IQGAP1 Antibody (H00008826-M01)

Discover related pathways, diseases and genes to IQGAP1 Antibody (H00008826-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IQGAP1 Antibody (H00008826-M01)

Discover more about diseases related to IQGAP1 Antibody (H00008826-M01).
 

Pathways for IQGAP1 Antibody (H00008826-M01)

View related products by pathway.

PTMs for IQGAP1 Antibody (H00008826-M01)

Learn more about PTMs related to IQGAP1 Antibody (H00008826-M01).
 

Research Areas for IQGAP1 Antibody (H00008826-M01)

Find related products by research area.

Blogs on IQGAP1

There are no specific blogs for IQGAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQGAP1 Antibody (2C5) and receive a gift card or discount.


Bioinformatics

Gene Symbol IQGAP1
Entrez
OMIM
Uniprot