Home » IQGAP1 » IQGAP1 Antibodies » IQGAP1 Antibody (2C5)

IQGAP1 Antibody (2C5)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Immunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.
Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IQGAP1 Antibody (2C5) Summary

Immunogen
IQGAP1 (NP_003861, 611 a.a. - 710 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Specificity
IQGAP1 - IQ motif containing GTPase activating protein 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IQGAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00008826-M01 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IQGAP1 Antibody (2C5)

  • HUMORFA01
  • IQ motif containing GTPase activating protein 1
  • IQGAP1
  • KIAA0051ras GTPase-activating-like protein IQGAP1
  • p195
  • p195RasGAP-like with IQ motifs
  • SAR1

Background

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
CDC42 Antibody
NBP2-14907
Western Blot: CDC42 Antibody [NBP2-14907] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDC42 antibody diluted at 1:500.
Immunohistochemistry-Paraffin: CDC42 Antibody [NBP2-14907] - Paraffin-embedded mouse brain. CDC42 antibody diluted at 1:500.
Western Blot: CDC42 Antibody [NBP2-14907] - Sample (50 ug of whole cell lysate) A: Mouse brain 12% SDS PAGE; antibody diluted at 1:1000.
(1 Review)
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Rac1 Antibody
NB100-91266
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex), Image is courtesy of customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunocytochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1 : 1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
AGTR-1 Antibody
NBP1-77078
Western Blot: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue lysate with Angiotensin II Type 1 Receptor antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: AGTR-1 Antibody [NBP1-77078] - Mouse Kidney cells.
Immunohistochemistry-Paraffin: AGTR-1 Antibody [NBP1-77078] - Mouse kidney tissue at 2.5 ug/mL.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Renin Antibody
AF4090
Renin was detected in immersion fixed paraffin-embedded sections of human kidney using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Renin was detected in immersion fixed paraffin-embedded sections of human kidney array using Sheep Anti-Human Renin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4090) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, IP, Neut
Calmodulin 2
Knockout HeLa Cell Ly
NBP2-66296
Calmodulin 2 Knockout HeLa Cell Lysate
Species: Hu
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Calmodulin 3
Antibody
NBP1-98474
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu
Applications: WB
Acetyl-coenzyme A
transporter 1 Antibod ...
H00009197-M07
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in PC-12 (Cat # L012V1).
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi or non-transfected control. Blot probed with H00009197-M07. GAPDH (36.1 kDa) used as loading control.
Western Blot: Acetyl-coenzyme A transporter 1 Antibody (3A4) [H00009197-M07] - Analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected lysatE (60.9 KDa). Lane 2: Non-transfected lysate.
(2 Publications)
Species: Hu, Rt
Applications: WB, ELISA
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104. (30 sec. exposure)
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton-X100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
(2 Reviews)
(79 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AGTR-2 Antibody
NBP1-77368
Western Blot: AGTR-2 Antibody [NBP1-77368] - Mouse liver tissue lysate with Angiotensin II Type 2 Receptor antibody at 0.5 ug/ml.
Immunohistochemistry-Paraffin: AGTR-2 Antibody [NBP1-77368] - Rat liver tissue with AGTR2 antibody at 5 ug/ml.
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(23 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
ACE/CD143 Antibody
[Unconjugated]
AF1513
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for IQGAP1 Antibody (H00008826-M01)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IQGAP1 Antibody (H00008826-M01) (0)

There are no reviews for IQGAP1 Antibody (H00008826-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IQGAP1 Antibody (H00008826-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IQGAP1 Products

Bioinformatics Tool for IQGAP1 Antibody (H00008826-M01)

Discover related pathways, diseases and genes to IQGAP1 Antibody (H00008826-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IQGAP1 Antibody (H00008826-M01)

Discover more about diseases related to IQGAP1 Antibody (H00008826-M01).
 

Pathways for IQGAP1 Antibody (H00008826-M01)

View related products by pathway.

PTMs for IQGAP1 Antibody (H00008826-M01)

Learn more about PTMs related to IQGAP1 Antibody (H00008826-M01).
 

Research Areas for IQGAP1 Antibody (H00008826-M01)

Find related products by research area.

Blogs on IQGAP1

There are no specific blogs for IQGAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IQGAP1 Antibody (2C5) and receive a gift card or discount.


Bioinformatics

Gene Symbol IQGAP1
Entrez
OMIM
Uniprot