KDM6A Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining in human bone marrow and skeletal muscle tissues using NBP1-80628 antibody. Corresponding KDM6A RNA-seq data are ...read more
Western Blot: KDM6A Antibody [NBP1-80628] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Red: UTX nuclear colocalization with DAPI (in blue). Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human cervix shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KDM6A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Specificity
Specificity of human KDM6A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KDM6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reported in the liturature (PMID: 29029452). KDM6A antibody validated for IHC-P from a verified customer review. Use in ICC/IF reported in scientific literature (PMID:32071397).
Control Peptide
KDM6A Protein (NBP1-80628PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80628 in the following applications:

Publications
Read Publications using
NBP1-80628 in the following applications:

  • 1 publication
  • IP
    1 publication
  • KD
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KDM6A Antibody

  • bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX))
  • bA386N14.2
  • DKFZp686A03225
  • EC 1.14.11
  • EC 1.14.11.-
  • Histone demethylase UTX
  • KABUK2
  • KDM6A
  • Lysine (K)specific Demethylase 6A
  • Lysine (K)-specific Demethylase 6A
  • MGC141941
  • ubiquitously transcribed tetratricopeptide repeat protein X-linked
  • ubiquitously transcribed tetratricopeptide repeat, X chromosome
  • ubiquitously transcribed TPR protein on the X chromosome
  • ubiquitously transcribed X chromosome tetratricopeptide repeat protein
  • ubiquitously-transcribed TPR gene on the X chromosome
  • Ubiquitously-transcribed TPR protein on the X chromosome
  • Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein
  • UTX
  • UTXlysine-specific demethylase 6A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06640
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NB110-83976
Species: Hu, Mu, Pm
Applications: WB
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
H00171023-M05
Species: Hu
Applications: WB, ELISA, IP
NBP2-94768
Species: Mu, Rt
Applications: WB
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-WhMt
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-52457
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-47804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-80628
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for KDM6A Antibody (NBP1-80628)(3)

Review for KDM6A Antibody (NBP1-80628) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80628:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin KDM6A NBP1-80628
Enlarge
5
reviewed by:
Anonymous
IHC-P Mouse 01/19/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedmouse uterus
SpeciesMouse

Comments

CommentsMouse uterus fixed in 4% PFA overnight. Citrate buffer retrieval, boiling for 10 minutes.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KDM6A Antibody (NBP1-80628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KDM6A Products

Bioinformatics Tool for KDM6A Antibody (NBP1-80628)

Discover related pathways, diseases and genes to KDM6A Antibody (NBP1-80628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KDM6A Antibody (NBP1-80628)

Discover more about diseases related to KDM6A Antibody (NBP1-80628).
 

Pathways for KDM6A Antibody (NBP1-80628)

View related products by pathway.

PTMs for KDM6A Antibody (NBP1-80628)

Learn more about PTMs related to KDM6A Antibody (NBP1-80628).

Blogs on KDM6A.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/19/2017
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol KDM6A
Entrez