KDM6A Antibody

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining in human bone marrow and skeletal muscle tissues using NBP1-80628 antibody. Corresponding KDM6A RNA-seq data are presented for the same tissues.

Western Blot: KDM6A Antibody [NBP1-80628] - HMLE cells were transduced with either an empty vector (HMLE-Vector), or genes encoding the EMT-inducing transcription factors Snail (HMLE-Snail) or Twist (HMLE-Twist) [4]. Whole-cell lysates were analyzed by immunoblotting for KDM6A. beta-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29029452/) licensed under a CC-BY license.

Western Blot: KDM6A Antibody [NBP1-80628] - Analysis in human cell line HEK 293.

Western Blot: KDM6A Antibody [NBP1-80628] - MCF-7 and MDA-MB-231 whole cell lysates (40 ug/lane). 10% SDS-PAGE. KDM6A Antibody (NBP1-80628) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Red: UTX nuclear colocalization with DAPI (in blue). Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human cervix shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.

Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KDM6A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KDM6A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence -Reported in scientific literature (PMID: 32071397).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KDM6A Protein (NBP1-80628PEP)

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KDM6A Antibody

• bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeatprotein (UTX))
• bA386N14.2
• DKFZp686A03225
• EC 1.14.11
• EC 1.14.11.-
• Histone demethylase UTX
• KABUK2
• KDM6A
• Lysine (K)specific Demethylase 6A
• Lysine (K)-specific Demethylase 6A
• MGC141941
• ubiquitously transcribed tetratricopeptide repeat protein X-linked
• ubiquitously transcribed tetratricopeptide repeat, X chromosome
• ubiquitously transcribed TPR protein on the X chromosome
• ubiquitously transcribed X chromosome tetratricopeptide repeat protein
• ubiquitously-transcribed TPR gene on the X chromosome
• Ubiquitously-transcribed TPR protein on the X chromosome
• Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein
• UTX
• UTXlysine-specific demethylase 6A

Background

UTX - ubiquitously transcribed tetratricopeptide repeat, X chromosome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KDM6A Antibody (NBP1-80628)(9)

Publications using NBP1-80628

• Yang Y, Chen C, Zuo Q Et al. NARF is a hypoxia-induced coactivator for OCT4-mediated breast cancer stem cell specification Sci Adv 2022-12-09 [PMID: 36490339] (WB, Chemotaxis, Human)
  
  Details:
  Citation using the DyLight 405 version of this antibody.
• Sohn HS, Choi JW, Jhun J Et al. Tolerogenic nanoparticles induce type II collagen-specific regulatory T cells and ameliorate osteoarthritis Sci Adv 2022-11-25 [PMID: 36427299] (IF/IHC, Mouse)
  
  Details:
  Citation using the FITC version of this antibody.
• Thaler R, Khani F, Sturmlechner I et al. Vitamin C epigenetically controls osteogenesis and bone mineralization Nature communications 2022-10-06 [PMID: 36202795] (WB, Mouse)
• de Souza AF, Bressan FF, Pieri NCG Et al. Generation of Primordial Germ Cell-like Cells from iPSCs Derived from Turner Syndrome Patients Cells 2021-11-10 [PMID: 34831322] (ICC/IF, Human)
• Lu H, Xie Y, Tran L et al. Chemotherapy-induced S100A10 recruits KDM6A to facilitate OCT4-mediated breast cancer stemness J Clin Invest. 2020-05-19 [PMID: 32427586] (KD, IP, WB, Human)
• Kato H, Asamitsu K, Sun W et al. Cancer-derived UTX TPR mutations G137V and D336G impair interaction with MLL3/4 complexes and affect UTX subcellular localization Oncogene 2020-02-18 [PMID: 32071397] (ICC/IF, Human)
• Taube JH, Sphyris N, Johnson KS et al. The H3K27me3-demethylase KDM6A is suppressed in breast cancer stem-like cells, and enables the resolution of bivalency during the mesenchymal-epithelial transition. Oncotarget. 2017-09-12 [PMID: 29029452] (WB, Human)
• Kim J Investigating miR-23a/b Regulation of KDM6A Protein Expression in Epithelial-Mesenchymal Transition Using Breast Cancer Cell Models Thesis 2021-01-01
• Yassin NYS, AbouZid SF, El-Kalaawy AM Et al. Silybum marianum total extract, silymarin and silibinin abate hepatocarcinogenesis and hepatocellular carcinoma growth via modulation of the HGF/c-Met, Wnt/beta-catenin, and PI3K/Akt/mTOR signaling pathways Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2021-11-12 [PMID: 34781148] (ICC/IF, Human)

Reviews for KDM6A Antibody (NBP1-80628) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Verified Customer WB Human 02/26/2021

Summary

• Application: Western Blot
• Sample Tested: breast cancer cell line, Sample Amount: 40
• Species: Human
• Lot: 0000018370

reviewed by: Priyanka Manandhar IHC-P Mouse 01/19/2017

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: mouse uterus
• Species: Mouse

Comments

• Comments: Mouse uterus fixed in 4% PFA overnight. Citrate buffer retrieval, boiling for 10 minutes.

Bioinformatics

• Gene Symbol: KDM6A
• Entrez:
  • 7403(Human)