SMYD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMYD3 Antibody [NBP2-58364] - Staining of human cell line RT4 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SMYD3 Antibody [NBP2-58364] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMYD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
Specificity
Specificity of human SMYD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMYD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SMYD3 Recombinant Protein Antigen (NBP2-58364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMYD3 Antibody

  • bA74P14.1 (novel protein)
  • bA74P14.1
  • EC 2.1.1
  • EC 2.1.1.43
  • FLJ21080
  • KMT3E
  • MGC104324
  • MYND domain containing 1
  • SET and MYND domain containing 3
  • SET and MYND domain-containing protein 3
  • Zinc finger MYND domain-containing protein 1
  • zinc finger protein, subfamily 3A (MYND domain containing), 1
  • ZMYND1
  • ZNFN3A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
7196-WN/CF
Species: Hu
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NBP2-20428
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP2-94769
Species: Rt
Applications: WB, IHC
NBP1-83186
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NB110-40585
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready, Dual ISH-IHC
NBP2-75545
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80628
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22152
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ChIP

Publications for SMYD3 Antibody (NBP2-58364) (0)

There are no publications for SMYD3 Antibody (NBP2-58364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMYD3 Antibody (NBP2-58364) (0)

There are no reviews for SMYD3 Antibody (NBP2-58364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMYD3 Antibody (NBP2-58364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMYD3 Products

Bioinformatics Tool for SMYD3 Antibody (NBP2-58364)

Discover related pathways, diseases and genes to SMYD3 Antibody (NBP2-58364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMYD3 Antibody (NBP2-58364)

Discover more about diseases related to SMYD3 Antibody (NBP2-58364).
 

Pathways for SMYD3 Antibody (NBP2-58364)

View related products by pathway.

PTMs for SMYD3 Antibody (NBP2-58364)

Learn more about PTMs related to SMYD3 Antibody (NBP2-58364).

Blogs on SMYD3

There are no specific blogs for SMYD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMYD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMYD3