SMYD3 Antibody - BSA Free

Western Blot: SMYD3 Antibody [NBP2-55477] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: SMYD3 Antibody [NBP2-55477] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, Leydig cells were strongly stained.

ChIP-Exo-Seq composite graph for Anti-SMYD3 (NBP2-55477) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMYD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMYD3 Antibody - BSA Free (NBP2-55477) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVR
• Predicted Species: Mouse (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMYD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMYD3 Recombinant Protein Antigen (NBP2-55477PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMYD3 Antibody - BSA Free

• bA74P14.1 (novel protein)
• bA74P14.1
• EC 2.1.1
• EC 2.1.1.43
• FLJ21080
• KMT3E
• MGC104324
• MYND domain containing 1
• SET and MYND domain containing 3
• SET and MYND domain-containing protein 3
• SMYD3
• Zinc finger MYND domain-containing protein 1
• zinc finger protein, subfamily 3A (MYND domain containing), 1
• ZMYND1
• ZNFN3A1

Background

SMYD3 is a histone methyltransferase that plays a role in transcriptional regulation as a member of an RNA polymerase complex.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMYD3