Slug Antibody (3C12)

Images

 
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on U-2 OS cell. Antibody concentration 10 ug/ml
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in PC-12 (Cat # L012V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in HepG2 (Cat # L019V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Slug Antibody (3C12) [H00006591-M05] - Analysis of SNAI2 expression in human liver.
Immunocytochemistry/ Immunofluorescence: Slug Antibody (3C12) [H00006591-M05] - Analysis of monoclonal antibody to SNAI2 on HepG2 cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Slug Antibody (3C12) Summary

Immunogen
SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Specificity
SNAI2 (3C12)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNAI2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Slug Antibody (3C12)

  • MGC10182
  • Neural crest transcription factor Slug
  • Protein snail homolog 2
  • slug homolog, zinc finger protein (chicken)
  • Slug
  • SLUGH
  • SLUGH1
  • SLUGzinc finger protein
  • SNAI2
  • snail 2
  • snail homolog 2 (Drosophila)
  • SNAIL2
  • WS2D
  • zinc finger protein SNAI2

Background

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF3639
Species: Hu
Applications: ChIP, ICC, ICFlow, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD, MiAr, Simple Western, Single-Cell Western, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
210-TA
Species: Hu
Applications: BA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, WB
236-EG
Species: Hu
Applications: BA
DMP900
Species: Hu
Applications: ELISA
H00006591-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Slug Antibody (H00006591-M05) (0)

There are no publications for Slug Antibody (H00006591-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slug Antibody (H00006591-M05) (0)

There are no reviews for Slug Antibody (H00006591-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Slug Antibody (H00006591-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Slug Products

Bioinformatics Tool for Slug Antibody (H00006591-M05)

Discover related pathways, diseases and genes to Slug Antibody (H00006591-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slug Antibody (H00006591-M05)

Discover more about diseases related to Slug Antibody (H00006591-M05).
 

Pathways for Slug Antibody (H00006591-M05)

View related products by pathway.

PTMs for Slug Antibody (H00006591-M05)

Learn more about PTMs related to Slug Antibody (H00006591-M05).
 

Research Areas for Slug Antibody (H00006591-M05)

Find related products by research area.

Blogs on Slug.


  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slug Antibody (3C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAI2
Entrez
OMIM
Uniprot