SLC25A37 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC25A37 Antibody [NBP1-93525] - Staining of human bronchus shows strong cytoplasmic, membranous and nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A37 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A37 Protein (NBP1-93525PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A37 Antibody

  • PRO1278
  • solute carrier family 25, member 37

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DNDG00
Species: Hu
Applications: ELISA
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-65543
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
233-FB/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
294-HG/CF
Species: Hu
Applications: BA
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
DCC270
Species: Hu
Applications: ELISA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

Publications for SLC25A37 Antibody (NBP1-93525) (0)

There are no publications for SLC25A37 Antibody (NBP1-93525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A37 Antibody (NBP1-93525) (0)

There are no reviews for SLC25A37 Antibody (NBP1-93525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC25A37 Antibody (NBP1-93525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A37 Products

Bioinformatics Tool for SLC25A37 Antibody (NBP1-93525)

Discover related pathways, diseases and genes to SLC25A37 Antibody (NBP1-93525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A37 Antibody (NBP1-93525)

Discover more about diseases related to SLC25A37 Antibody (NBP1-93525).
 

Pathways for SLC25A37 Antibody (NBP1-93525)

View related products by pathway.

Blogs on SLC25A37

There are no specific blogs for SLC25A37, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A37