SLC25A20 Antibody

Images

 
Western Blot: SLC25A20 Antibody [NBP1-86690] - Analysis in control (vector only transfected HEK293T lysate) and SLC25A20 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Western Blot: SLC25A20 Antibody [NBP1-86690] - Analysis of SLC25A20 in murine ear mesenchymal stem cells (mEMSC) adipocytes using anti-SLC25A20 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SLC25A20 Antibody [NBP1-86690] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR
Specificity
Specificity of human, mouse SLC25A20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot verified by a customer review.
Control
SLC25A20 Knockout HeLa Cell Lysate
Control Peptide
SLC25A20 Protein (NBP1-86690PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86690 in the following applications:

Publications
Read Publication using NBP1-86690.

Reactivity Notes

Analysis in mouse ear mesenchymal stem cells (mEMSC) adipocytes. Image from verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A20 Antibody

  • CACCarnitine/acylcarnitine translocase
  • CACTSolute carrier family 25 member 20
  • mitochondrial carnitine/acylcarnitine carrier protein
  • solute carrier family 25 (carnitine/acylcarnitine translocase), member 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002316-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A20 Antibody (NBP1-86690)(1)

Review for SLC25A20 Antibody (NBP1-86690) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-86690:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SLC25A20 NBP1-86690
Enlarge
5
reviewed by:
Anonymous
WB Mouse 04/30/2015
View

Summary

ApplicationWestern Blot
Sample TestedMurine ear mesenchymal stem cells (mEMSC) adipocytes
SpeciesMouse

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsLane1&2: isolated mitochondria from differentiated adipocytesLane3&4: whole cell lysate from differentiated adipocytesATP-beta used as a mitochodrial marker

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A20 Antibody (NBP1-86690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A20 Products

Bioinformatics Tool for SLC25A20 Antibody (NBP1-86690)

Discover related pathways, diseases and genes to SLC25A20 Antibody (NBP1-86690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A20 Antibody (NBP1-86690)

Discover more about diseases related to SLC25A20 Antibody (NBP1-86690).
 

Pathways for SLC25A20 Antibody (NBP1-86690)

View related products by pathway.

PTMs for SLC25A20 Antibody (NBP1-86690)

Learn more about PTMs related to SLC25A20 Antibody (NBP1-86690).

Blogs on SLC25A20

There are no specific blogs for SLC25A20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
04/30/2015
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SLC25A20