PCYT1A Antibody

Images

 
Western Blot: PCYT1A Antibody [NBP1-84366] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: PCYT1A Antibody [NBP1-84366] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PCYT1A Antibody [NBP1-84366] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCYT1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCYT1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCYT1A Protein (NBP1-84366PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCYT1A Antibody

  • CCT A
  • CCT-alpha
  • choline-phosphate cytidylyltransferase A
  • CT A
  • CT
  • CTA
  • CTP:phosphocholine cytidylyltransferase A
  • CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform
  • EC 2.7.7
  • EC 2.7.7.15
  • PCYT1CCTA
  • phosphate cytidylyltransferase 1, choline, alpha
  • Phosphorylcholine transferase A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-35213
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84366
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PCYT1A Antibody (NBP1-84366) (0)

There are no publications for PCYT1A Antibody (NBP1-84366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCYT1A Antibody (NBP1-84366) (0)

There are no reviews for PCYT1A Antibody (NBP1-84366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCYT1A Antibody (NBP1-84366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYT1A Products

Bioinformatics Tool for PCYT1A Antibody (NBP1-84366)

Discover related pathways, diseases and genes to PCYT1A Antibody (NBP1-84366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYT1A Antibody (NBP1-84366)

Discover more about diseases related to PCYT1A Antibody (NBP1-84366).
 

Pathways for PCYT1A Antibody (NBP1-84366)

View related products by pathway.

PTMs for PCYT1A Antibody (NBP1-84366)

Learn more about PTMs related to PCYT1A Antibody (NBP1-84366).

Blogs on PCYT1A

There are no specific blogs for PCYT1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCYT1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCYT1A