PCYT1A Antibody

Images

 
Western Blot: PCYT1A Antibody [NBP1-84366] - Analysis in human cell line EFO-21.
Immunocytochemistry/ Immunofluorescence: PCYT1A Antibody [NBP1-84366] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PCYT1A Antibody [NBP1-84366] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCYT1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVR
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCYT1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCYT1A Protein (NBP1-84366PEP)
Reviewed Applications
Read 1 Review rated 1
using
NBP1-84366 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PCYT1A Antibody

  • CCT A
  • CCT-alpha
  • choline-phosphate cytidylyltransferase A
  • CT A
  • CT
  • CTA
  • CTP:phosphocholine cytidylyltransferase A
  • CTPCT
  • CTPCTphosphate cytidylyltransferase 1, choline, alpha isoform
  • EC 2.7.7
  • EC 2.7.7.15
  • PCYT1
  • PCYT1A
  • PCYT1CCTA
  • phosphate cytidylyltransferase 1, choline, alpha
  • Phosphorylcholine transferase A
  • SMDCRD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45861
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-1397
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
MAB7665
Species: Hu
Applications: IHC, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for PCYT1A Antibody (NBP1-84366) (0)

There are no publications for PCYT1A Antibody (NBP1-84366).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PCYT1A Antibody (NBP1-84366) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP1-84366:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PCYT1A NBP1-84366
Enlarge
1
reviewed by:
Verified Customer
Western Blot Human and Mouse 10/15/2021
View

Summary

ApplicationWestern Blot
Sample TestedHepG2,Liver,Mouse brain
SpeciesHuman and Mouse
LotA93759

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCYT1A Antibody (NBP1-84366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCYT1A Products

Bioinformatics Tool for PCYT1A Antibody (NBP1-84366)

Discover related pathways, diseases and genes to PCYT1A Antibody (NBP1-84366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCYT1A Antibody (NBP1-84366)

Discover more about diseases related to PCYT1A Antibody (NBP1-84366).
 

Pathways for PCYT1A Antibody (NBP1-84366)

View related products by pathway.

PTMs for PCYT1A Antibody (NBP1-84366)

Learn more about PTMs related to PCYT1A Antibody (NBP1-84366).
 

Research Areas for PCYT1A Antibody (NBP1-84366)

Find related products by research area.

Blogs on PCYT1A

There are no specific blogs for PCYT1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Verified Customer
10/15/2021
Application: Western Blot
Species: Human and Mouse

Bioinformatics

Gene Symbol PCYT1A