SLC25A10 Antibody

Images

 
Western Blot: SLC25A10 Antibody [NBP1-85214] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: SLC25A10 Antibody [NBP1-85214] - Staining of human cell line A-431 shows positivity in mitochondria.
Immunohistochemistry-Paraffin: SLC25A10 Antibody [NBP1-85214] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC25A10 Protein (NBP1-85214PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A10 Antibody

  • dicarboxylate ion carrier
  • DICSolute carrier family 25 member 10
  • member 10
  • mitochondrial dicarboxylate carrier
  • solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP2-07799
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP1-85214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC25A10 Antibody (NBP1-85214) (0)

There are no publications for SLC25A10 Antibody (NBP1-85214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A10 Antibody (NBP1-85214) (0)

There are no reviews for SLC25A10 Antibody (NBP1-85214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC25A10 Antibody (NBP1-85214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A10 Products

Bioinformatics Tool for SLC25A10 Antibody (NBP1-85214)

Discover related pathways, diseases and genes to SLC25A10 Antibody (NBP1-85214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A10 Antibody (NBP1-85214)

Discover more about diseases related to SLC25A10 Antibody (NBP1-85214).
 

Pathways for SLC25A10 Antibody (NBP1-85214)

View related products by pathway.

PTMs for SLC25A10 Antibody (NBP1-85214)

Learn more about PTMs related to SLC25A10 Antibody (NBP1-85214).

Blogs on SLC25A10

There are no specific blogs for SLC25A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A10